KEGG   Burkholderia mallei SAVP1: BMASAVP1_A1339Help
Entry
BMASAVP1_A1339    CDS       T00457                                 

Definition
1,4-alpha-glucan-branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bmv  Burkholderia mallei SAVP1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bmv00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BMASAVP1_A1339
Enzymes [BR:bmv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     BMASAVP1_A1339
Exosome [BR:bmv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BMASAVP1_A1339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1312971..1313819)
Genome map
AA seq 282 aa AA seqDB search
MTDAPFDRADIDALLDARHPDPFACLGPHRVGDATVVRTLLPGALRVRAIAAGGGVLGEL
RQVDPAGCFAGALPDGQERGEQPRYRLSIDWPDARQDVEDAYAFGTLLDEDALARFAAGD
PRAALACLGARALDMDGVPGVRFAVWAPGASRVSVVGDFNGWDARRHPMRLRRPWGVWEL
FVPRIGAGERYKFALRARDGAALPLKADPCACRTEAPPRTASIVADLDALERFGWHDDAW
LRARRSISRTRRCRSTKSIRNRGCASRPRAIAARRGTSSRSG
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgacggatgcgcccttcgatcgcgccgacatcgacgcgctcctcgacgcgcgccatccg
gacccgttcgcgtgcctcggcccgcaccgcgtcggcgacgcgacggtcgtgcgcacgctg
ctgcccggcgcgctgcgggttcgcgcgatcgcggcgggcggcggcgtgctcggcgagctg
cggcaggtcgatccggccggctgcttcgccggcgcgctgcccgatgggcaggaacgcggc
gagcagccgcgctatcggctgtcgatcgactggcccgacgcgcgacaggacgtggaggac
gcgtatgcgttcggcacgctgctcgacgaggatgcgctcgcgcgcttcgcggcgggcgat
ccgcgcgcggcgctcgcgtgcctcggcgcgcgcgcgctcgacatggatggcgtgcccggc
gtgcggttcgccgtctgggcgccgggcgcgtcgcgcgtgtcggtggtcggcgatttcaac
ggctgggatgcgcgccgccacccgatgcggctgcgccgcccgtggggcgtgtgggagctg
ttcgtgccgcgcatcggcgcgggcgagcgctacaagttcgcgctgcgcgcgcgcgacggc
gccgcgctgccgctgaaggccgacccgtgcgcgtgccgcaccgaggcgccgccgcgcacc
gcgtcgatcgtcgccgatctcgacgcgctcgagcgcttcggctggcacgacgacgcgtgg
ctgcgcgcgcgtcgctcgatctcgcgcacgcgccggtgtcgatctacgaagtccatccgg
aatcgtggctgcgcgtcgcggccgagggcaatcgcagcgcgacgtgggacgagctcgcgc
agcggctga

DBGET integrated database retrieval system