KEGG   Burkholderia mallei SAVP1: BMASAVP1_A1412Help
Entry
BMASAVP1_A1412    CDS       T00457                                 

Definition
di-heme cytochrome c peroxidase family protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
bmv  Burkholderia mallei SAVP1
Brite
Enzymes [BR:bmv01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     BMASAVP1_A1412
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1380390..1381805
Genome map
AA seq 471 aa AA seqDB search
MMRRLPRYARQHRSFFVAPRAFAAAAALAAGVAACDANGPGASAAAAVAPAVPAASAASA
ASAASAARPAPLAQPAAPAVVDSQPQTRAQVYEAVKQMTALGRQLFFDPSLSGSGKLACA
SCHSPQHAFGPPNALPAQFGGDDLRQQGFRAVPTLKYLQKVPAFSEHYHESDDEGDESVD
AGPTGGLTWDGRVDSGAEQARVPLTSPFEMNGTPEKVARAVRAAPYAPAFRAAFGARVLD
DDRATFEAVLQALGTFEQAPDVFYPYTSKYDAYLAGRARLTRAELHGLQVFNDEKKGNCA
SCHVSRRGLDGSPPQFSDFGLIALGVPRNRALAVNRNPNFYDLGACGPERRDLKGRDEFC
GLFRTPTLRNVALKKTFFHNGVYHSLDDVLRFYAERDTHPEKFYPVKRGVVQKFDDLPKR
YWKNLNDEPPFERKRGDPPAMTDAEIRDVIAFLGTLTDGYDPRAKPAGGAR
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgccgcttgccgcgatacgcccgccagcaccgttcgttcttcgtcgcgccgcgc
gcgttcgcggccgccgccgcgcttgccgcgggcgtcgccgcgtgtgacgcgaacgggccg
ggcgcgagcgccgccgcggccgtcgcgcccgctgtcccagccgcttccgctgcttccgct
gcctccgctgcctccgctgcgcgtcccgcgcctctcgcgcagccggccgcgcccgccgtc
gtcgacagtcagccgcagacgcgcgcgcaggtgtacgaggcggtcaagcagatgacggcg
ctcggcaggcagttgttcttcgatccttcgctgtcgggcagcggcaagctcgcctgcgcg
tcgtgccacagcccgcagcacgcgttcgggccgccgaacgcgctgcccgcgcaattcggc
ggcgacgatctgcgccagcagggctttcgcgccgtgccgacgctcaaatacctgcagaag
gtgcccgcgttcagcgagcactatcacgaatcggacgacgagggcgacgagagcgtcgac
gccggcccgacgggcgggctcacgtgggacggccgcgtggacagcggcgccgagcaggcg
cgcgtgccgctcacgtcgccgttcgagatgaacggcacgcccgagaaggtcgcgcgcgcg
gtgcgggccgcgccgtacgcgcccgcgtttcgcgcggcgttcggcgcgcgcgtgctcgac
gacgaccgcgcgacgttcgaggcggtgctgcaggcgctcggcacgttcgagcaggcgccc
gacgtgttctatccgtacacgagcaagtacgacgcgtacctggcgggccgcgcgcggttg
acgcgcgccgagctgcacgggctgcaggtcttcaacgacgagaagaagggcaactgcgcg
agctgccacgtgagccggcgcgggctcgacggctcgccgccgcagttcagcgatttcggc
ctgatcgcgctcggcgtgccgcgcaatcgcgcgctcgcggtgaatcggaatccgaatttt
tacgacctcggcgcatgcgggcccgagcgccgggacctgaaggggcgcgacgagttctgc
gggctgttccgcacgccgacgctgcgtaacgtcgcgctgaagaagacgttcttccacaac
ggcgtctatcactcgctcgacgacgtgctgcgcttctacgccgagcgcgacacgcatccg
gaaaagttctatccggtgaagcgcggcgtcgttcagaagttcgacgacttgccgaagcgt
tactggaagaacctgaacgacgagccgccgttcgagcgcaagcgcggcgatccgcccgcg
atgaccgatgcggagatccgggacgtgatcgcgttcctcggcacgctcaccgacggctac
gatccgcgcgcgaagccggcaggcggcgcgcgctga

DBGET integrated database retrieval system