KEGG   Burkholderia mallei SAVP1: BMASAVP1_A1743Help
Entry
BMASAVP1_A1743    CDS       T00457                                 

Gene name
rpiA
Definition
ribose-5-phosphate isomerase A (EC:5.3.1.6)
Orthology
K01807  
ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
bmv  Burkholderia mallei SAVP1
Pathway
Pentose phosphate pathway
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Class
Metabolism; Overview; Carbon metabolism [PATH:bmv01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:bmv01230]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:bmv00030]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:bmv00710]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
I:complement(1726269..1726964)
Genome map
AA seq 231 aa AA seqDB search
MTQDELKRLVGEAAARYVTENVPQGAVIGVGTGSTANCFIDALAAVKDRYRGAVSSSVAT
TERLKSHGIKVFDLNEIESLQVYVDGADEIDGSGAMIKGGGGALTREKIVASVAETFVCI
ADASKRVAVLGQFPLPVEVVPMARTAIGRRLAALGGVPVLRVKQDGAPYVTDNGNEILDV
KGLRIDDPRALEAAINGWPGVVTVGLFAQRGADLCLLGTERGVETLRYAAH
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgacacaagacgaactcaaacgcctcgtcggcgaggccgctgcccgatacgtgaccgaa
aacgtgccgcagggcgcggtgatcggcgtcggcacgggctcgaccgccaactgcttcatc
gatgcgctcgcggccgtcaaggatcgctatcgcggcgcggtgtcgagttcggtggcgacg
accgagcgcctgaagtcacacggcatcaaggtgttcgatctgaacgagatcgaatcgctg
caggtgtatgtcgacggcgccgacgagatcgacgggagcggcgcgatgatcaagggcggc
ggcggcgcgctcacgcgcgagaagatcgttgcttcggttgccgaaacgttcgtgtgcatc
gccgatgcgagcaagcgcgtggcggtgctcggccagttcccgctgcccgtcgaggtggtg
ccgatggcgcgcaccgcgatcggccgccggctcgccgcgctgggcggcgtgcccgtgctg
cgcgtgaagcaggacggcgcgccgtacgtgaccgacaacggcaacgagattctcgacgtg
aagggcctgcggatcgacgatccgcgcgcgctcgaagcggcgatcaacggctggcccggc
gtcgtgacggtcgggctgttcgcgcaacgcggcgcggatctctgcctgctcggcaccgag
cgcggcgtcgagacgctccgttacgctgcgcattaa

DBGET integrated database retrieval system