KEGG   Burkholderia mallei SAVP1: BMASAVP1_A1743Help
Entry
BMASAVP1_A1743    CDS       T00457                                 

Gene name
rpiA
Definition
ribose-5-phosphate isomerase A (EC:5.3.1.6)
Orthology
K01807  
ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
bmv  Burkholderia mallei SAVP1
Pathway
Pentose phosphate pathway
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:bmv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BMASAVP1_A1743 (rpiA)
   01230 Biosynthesis of amino acids
    BMASAVP1_A1743 (rpiA)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BMASAVP1_A1743 (rpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BMASAVP1_A1743 (rpiA)
Enzymes [BR:bmv01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     BMASAVP1_A1743 (rpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1726269..1726964)
Genome map
AA seq 231 aa AA seqDB search
MTQDELKRLVGEAAARYVTENVPQGAVIGVGTGSTANCFIDALAAVKDRYRGAVSSSVAT
TERLKSHGIKVFDLNEIESLQVYVDGADEIDGSGAMIKGGGGALTREKIVASVAETFVCI
ADASKRVAVLGQFPLPVEVVPMARTAIGRRLAALGGVPVLRVKQDGAPYVTDNGNEILDV
KGLRIDDPRALEAAINGWPGVVTVGLFAQRGADLCLLGTERGVETLRYAAH
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgacacaagacgaactcaaacgcctcgtcggcgaggccgctgcccgatacgtgaccgaa
aacgtgccgcagggcgcggtgatcggcgtcggcacgggctcgaccgccaactgcttcatc
gatgcgctcgcggccgtcaaggatcgctatcgcggcgcggtgtcgagttcggtggcgacg
accgagcgcctgaagtcacacggcatcaaggtgttcgatctgaacgagatcgaatcgctg
caggtgtatgtcgacggcgccgacgagatcgacgggagcggcgcgatgatcaagggcggc
ggcggcgcgctcacgcgcgagaagatcgttgcttcggttgccgaaacgttcgtgtgcatc
gccgatgcgagcaagcgcgtggcggtgctcggccagttcccgctgcccgtcgaggtggtg
ccgatggcgcgcaccgcgatcggccgccggctcgccgcgctgggcggcgtgcccgtgctg
cgcgtgaagcaggacggcgcgccgtacgtgaccgacaacggcaacgagattctcgacgtg
aagggcctgcggatcgacgatccgcgcgcgctcgaagcggcgatcaacggctggcccggc
gtcgtgacggtcgggctgttcgcgcaacgcggcgcggatctctgcctgctcggcaccgag
cgcggcgtcgagacgctccgttacgctgcgcattaa

DBGET integrated database retrieval system