KEGG   Burkholderia mallei SAVP1: BMASAVP1_A1927Help
Entry
BMASAVP1_A1927    CDS       T00457                                 

Gene name
pncA
Definition
pyrazinamidase/nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
bmv  Burkholderia mallei SAVP1
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:bmv00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
I:complement(1907617..1908255)
Genome map
AA seq 212 aa AA seqDB search
MQRTDDVLLVIDVQNDFMPGGALAVAHGDEVVPAINRLAARFDHVVLTQDWHPRDHVSFA
ANHPGRAPFSTLALPYGEQVLWPVHCVQGTHGAALHGDLDIPHARLVVRKGHRASVDSYS
AFVEADRRTPTGLAGYLREIGAKRVWCCGFATDYCVAWSALDARAAGFDAAVIEDACRAI
DLDGSLARAWASLAAAGVARVQSAEVCPGVDP
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgcaccgacgatgtccttctcgtgatcgacgtgcagaacgatttcatgccgggc
ggcgcgctcgcggtcgcgcacggcgacgaagtcgtgccggcgatcaaccggctcgccgcg
cgcttcgatcacgtcgtgctgacgcaggattggcatccgcgcgatcacgtgtcgttcgcg
gcgaaccatccgggccgcgcgccgttctcgacgctcgcgctgccgtacggcgagcaggtg
ctgtggcccgtccactgcgtgcagggcacgcacggcgcggcgctgcacggcgatctcgac
atcccgcacgcgcggctcgtggtccgcaaggggcatcgcgcgtcggtcgacagctactcg
gcgttcgtcgaggccgaccgccgcacgccgaccgggcttgccggctatctgcgcgaaatc
ggcgccaagcgcgtgtggtgctgcgggttcgcgaccgactattgcgtcgcgtggtccgcg
ctcgatgcgcgcgccgcgggcttcgacgcggccgtgatcgaggacgcgtgccgcgcgatc
gatctcgacggctcgctcgcgcgcgcatgggcgtcgctcgccgcggcgggcgtcgcgcgc
gtgcagtcggccgaggtttgcccgggcgtcgatccgtag

DBGET integrated database retrieval system