KEGG   Burkholderia mallei SAVP1: BMASAVP1_A2074Help
Entry
BMASAVP1_A2074    CDS       T00457                                 

Gene name
bsaA
Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
bmv  Burkholderia mallei SAVP1
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:bmv00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:bmv00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
I:complement(2051180..2051659)
Genome map
AA seq 159 aa AA seqDB search
MSKLYSFNAQALSGGEVPLEQYRGKVLLIVNTASECGFTPQYAGLQQLYDRFRERGLVVL
GFPCNQFGKQEPGDASQIGAFCEKNYGVTFPMFGKIDVNGANAHPLYRYLTEEAPGILGL
KAIKWNFTKFLVNREGEIVKRYAPSTKPEDIAADVEKLL
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaactgtattcattcaacgcgcaggcgctttcggggggcgaggtgccgctcgag
caataccggggcaaggtgctcctcatcgtcaacacggcgagcgagtgcggattcacgccg
cagtacgcggggctgcagcaactgtacgatcgctttcgcgaacgcgggcttgtcgtgctc
ggctttccgtgcaatcagttcggcaagcaggagccgggcgatgcgtcgcagatcggcgcg
ttctgcgagaagaattacggcgtcacgttcccgatgttcgggaagatcgatgtgaacggc
gcgaacgcgcacccgctataccggtatctgaccgaggaggcgcccggcattctcggcctg
aaggcgatcaagtggaatttcacgaagttcctcgtgaaccgggaaggcgagatcgtgaag
cgctatgcgccgtcgacgaagcccgaggatatcgccgcggacgtcgaaaagctgctttga

DBGET integrated database retrieval system