KEGG   Burkholderia mallei SAVP1: BMASAVP1_A2530Help
Entry
BMASAVP1_A2530    CDS       T00457                                 

Gene name
folA
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
bmv  Burkholderia mallei SAVP1
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bmv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BMASAVP1_A2530 (folA)
   00670 One carbon pool by folate
    BMASAVP1_A2530 (folA)
Enzymes [BR:bmv01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     BMASAVP1_A2530 (folA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
I:2514267..2514770
Genome map
AA seq 167 aa AA seqDB search
MTTLTLIVARARNGVIGRDNRLPWKLPEDLAFFKRTTMGAPIVMGRKTHESIGRPLPGRR
NIVVTRDAARRFDGCDTVTSLDDALALAARDGAAEAFLIGGAQLYEEGLRHADKLIVTEI
DQDFEGDASFPAPDPAQWEAVSRDAHRAAQPNDFTYAFVVYRRRRAG
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgctgaccttgatcgtcgcgcgcgcccgcaacggcgtgatcggccgcgacaac
cgacttccgtggaaactccccgaggacctcgcgttcttcaagcgcacgacgatgggcgcg
ccgatcgtgatgggccgcaagacgcacgaatcgatcggccggccgctgccggggcgccgc
aacatcgtcgtcacgcgcgacgccgcgcgccgcttcgacggctgcgacacggtcacctcg
ctcgacgacgcgctcgcgctcgccgcgcgcgacggcgcggccgaagcgttcctgatcggc
ggcgcgcaactgtacgaggaaggcctgcgccacgcggacaagctgatcgtcaccgaaatc
gatcaggatttcgaaggtgacgcgtcgttccccgcgcccgatcccgcgcaatgggaagcc
gtgtcgcgcgacgcgcaccgcgcggcgcagcccaacgatttcacgtacgcgttcgtcgtc
tatcgccgcaggcgcgccggctga

DBGET integrated database retrieval system