KEGG   Burkholderia mallei SAVP1: BMASAVP1_A2653Help
Entry
BMASAVP1_A2653    CDS       T00457                                 

Definition
fatty acid desaturase family protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
bmv  Burkholderia mallei SAVP1
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bmv00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    BMASAVP1_A2653
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    BMASAVP1_A2653
Enzymes [BR:bmv01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     BMASAVP1_A2653
Lipid biosynthesis proteins [BR:bmv01004]
 Desaturase
  First
   BMASAVP1_A2653
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
I:complement(2627786..2628982)
Genome map
AA seq 398 aa AA seqDB search
MLNSLLDFLSNGLLRFSWWQIVLFTLAVTHVTIVGVTVYLHRCQAHRALDLHPIMSHFFR
AWLWMTTGMLTGQWAAIHRKHHAKCETEEDPHSPQTRGIWKVLLEGAELYRAEAKNEETM
RKYGHGTPNDWLERNVYSKYPILGVSLMMVIDVALFGLVGLTVWAVQMVWIPFWAAGVVN
GLGHFWGYRNFNAADASTNLFPWGIVIGGEELHNNHHTFATSAKLSNKWYEFDIGWMYIR
IMSAFGLAKVKKIAPTPRLAARKTVLDQETLQAVLSNRYEVMARYAKTLKRAYRQELAHL
KELGAREKYQLMRGARKWFHKDEAGLDEPQKRMLPEIFANSQKLHTFFQLRAELTAIWER
SNASREQLLTQLQDWCHRAEQSGIKALQEFATRLRRYA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
ttgttgaattccctgctcgatttcctttccaacgggcttctgcgtttctcgtggtggcag
atcgtgctgttcacgctcgccgtcacgcacgtgacgatcgtcggcgtgacggtctatctg
catcgctgccaggcacaccgcgcgctcgatctgcatccgatcatgagccacttcttccgc
gcctggctgtggatgacgacgggcatgctgacgggccagtgggcggcgatccatcgcaag
caccatgcgaagtgcgagaccgaggaggatccgcacagcccgcagacgcgcggcatctgg
aaggtgctgctcgaaggcgccgagctgtatcgtgcggaggcgaagaacgaggagacgatg
cgcaagtacggccacggcacgccgaacgactggctcgagcgcaacgtctactcgaaatac
ccgattctcggcgtgagcctgatgatggtgatcgacgtcgcgctgttcggcctcgtcggc
ctcaccgtctgggcagtccagatggtgtggatcccattctgggcggcgggcgtcgtcaac
ggtctcggccacttctggggctaccgcaacttcaacgcggccgacgcgagcacgaacctg
tttccgtggggcatcgtgatcggcggcgaggagctgcacaacaatcatcatacgtttgcg
acgtcggcgaagctgtcgaacaagtggtacgagttcgacatcggctggatgtacatccgc
atcatgtcggcgttcgggctcgcgaaggtaaagaagatcgcgccgacgccgcggctcgcc
gcgcgcaagacggtgctcgaccaggaaacgctgcaggccgtgctgtcgaaccgttacgag
gtgatggcgcgctatgcgaagacgctcaagcgcgcgtacaggcaggagctcgcgcacctg
aaggagctgggcgcgcgcgagaagtatcagctgatgcgcggcgcgcgcaaatggttccac
aaggacgaggcgggcctcgacgagccgcagaagcggatgctgccggagatcttcgcgaac
agccagaagctgcacacgttcttccaactgcgcgccgagctcacggcgatctgggagcgc
tcgaacgcctcgcgcgaacagctgctcacgcagttgcaggactggtgccatcgcgccgag
caaagcggcatcaaggcgttgcaggagttcgcgacgcgcctgcgccgctacgcgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system