KEGG   Burkholderia mallei SAVP1: BMASAVP1_A2706Help
Entry
BMASAVP1_A2706    CDS       T00457                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bmv  Burkholderia mallei SAVP1
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmv00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    BMASAVP1_A2706 (glpK)
Enzymes [BR:bmv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     BMASAVP1_A2706 (glpK)
Exosome [BR:bmv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BMASAVP1_A2706 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
I:2683536..2685092
Genome map
AA seq 518 aa AA seqDB search
MRRARGANHNYVRMEMRQMQDQYILALDQGTTSSRAMLFDRQGNIVSIAQKEFEQIYPQP
GWVEHDPQEIWSTQAGVAAEAVTRVGLNGTAIAAIGITNQRETTIVWDRETGHPIYNAIV
WQDRRTADFCDKLKAQGLSEKVRAKTGLPIDSYFSATKIRWILDNVEGAREKARQGKLAF
GTVDSWLVWNFTKHELHVTDVTNASRTMLFNIHTLDWDDELLDALEIPRSMLPQVRASSE
IYGPTKTTVFASKIPLAGIAGDQQAALFGQMCTSSGMVKNTYGTGCFLMMNTGETPIESR
NNLVTTIAWQVDGKVSYALEGSIFIAGAVVQWLRDGLGIIKSASEIEALAAGVPHTDGVY
LVPAFAGLGAPHWNARARGSLFGVTRGTTSAHLARAALDSIAYQSLDVLKAMEADSGIRI
GELRVDGGASANNLLMQFQADLLGVDAVRPRITETTALGAAYLAGLAIGYWQNVDELHSQ
WQLERRFAPSMQAEQVGSCLAGWQRAVRAAKAWADDTQ
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
gtgcgccgcgcccgcggcgccaatcacaactacgtacggatggagatgagacagatgcag
gaccagtacatcctcgcgctcgaccagggcacgaccagctcccgcgccatgctgttcgat
cgacaaggcaacatcgtatcgatcgcgcagaaggaattcgagcaaatttatccgcagccg
ggctgggtcgagcacgatccccaggagatctggtcgacgcaggcgggcgtcgcggccgag
gccgtcacgcgcgtcggcctgaacggcacggcgatcgccgcgatcggcatcacgaaccag
cgcgagacgacgatcgtctgggatcgcgagacgggtcatccgatctacaacgcgatcgtc
tggcaggatcgccgcaccgccgatttctgcgacaagctcaaggcgcagggcctcagcgag
aaggtgcgcgcgaagacgggcctgccgatcgactcgtacttctcggccaccaagatccgc
tggattctcgacaacgtcgagggcgcgcgcgagaaggcgcgccagggcaagctcgcgttc
ggcacggtcgacagctggctcgtgtggaacttcacgaagcacgagctgcacgtgaccgac
gtgacgaacgcgtcgcgcacgatgctcttcaacatccacacgctcgactgggacgacgag
ttgctcgacgcactcgagattccgcgcagcatgctgccgcaagtgcgcgcgtcctccgag
atctacgggccgacgaagaccaccgtgttcgcctcgaagattccgctcgccggcatcgcg
ggcgatcagcaggccgcgctcttcggccagatgtgcacgagctcgggcatggtgaagaac
acctacggcaccggctgcttcctgatgatgaacaccggcgagacgccgatcgaatcgcgg
aacaacctcgtcacgacgatcgcctggcaagtcgacggcaaggtcagctacgcgctcgaa
ggcagcatcttcatcgcgggcgcggtcgtgcagtggctgcgcgacgggctcggcatcatc
aagagcgcgtcggagatcgaggcgctcgccgccggcgtgccgcacacggacggcgtctat
ctcgtgcccgcgttcgccggcctcggcgcgccgcactggaacgcgcgcgcccgcggctcg
ctgttcggcgtcacgcgcggcacgacgtccgcgcacctcgcgcgcgcggcgctcgattcg
atcgcgtatcaatcgctcgacgtgctcaaggccatggaggccgattcgggcatccgcatc
ggcgagctgcgcgtggacggcggcgcgagcgcgaacaacctgctgatgcagttccaggcg
gatctgctcggcgtcgacgcggtgcgcccgcgcatcaccgagacgaccgcgctcggcgcc
gcgtatctcgcgggcctcgcgatcggctactggcagaacgtcgacgagctgcacagccaa
tggcagctcgagcgccgcttcgcgccttcgatgcaggccgagcaggtgggctcttgcctc
gccggctggcagcgcgcggtgcgcgcggcgaaggcatgggcggacgacacgcagtaa

DBGET integrated database retrieval system