KEGG   Burkholderia mallei SAVP1: BMASAVP1_A2706Help
Entry
BMASAVP1_A2706    CDS       T00457                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bmv  Burkholderia mallei SAVP1
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:bmv00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
I:2683536..2685092
Genome map
AA seq 518 aa AA seqDB search
MRRARGANHNYVRMEMRQMQDQYILALDQGTTSSRAMLFDRQGNIVSIAQKEFEQIYPQP
GWVEHDPQEIWSTQAGVAAEAVTRVGLNGTAIAAIGITNQRETTIVWDRETGHPIYNAIV
WQDRRTADFCDKLKAQGLSEKVRAKTGLPIDSYFSATKIRWILDNVEGAREKARQGKLAF
GTVDSWLVWNFTKHELHVTDVTNASRTMLFNIHTLDWDDELLDALEIPRSMLPQVRASSE
IYGPTKTTVFASKIPLAGIAGDQQAALFGQMCTSSGMVKNTYGTGCFLMMNTGETPIESR
NNLVTTIAWQVDGKVSYALEGSIFIAGAVVQWLRDGLGIIKSASEIEALAAGVPHTDGVY
LVPAFAGLGAPHWNARARGSLFGVTRGTTSAHLARAALDSIAYQSLDVLKAMEADSGIRI
GELRVDGGASANNLLMQFQADLLGVDAVRPRITETTALGAAYLAGLAIGYWQNVDELHSQ
WQLERRFAPSMQAEQVGSCLAGWQRAVRAAKAWADDTQ
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
gtgcgccgcgcccgcggcgccaatcacaactacgtacggatggagatgagacagatgcag
gaccagtacatcctcgcgctcgaccagggcacgaccagctcccgcgccatgctgttcgat
cgacaaggcaacatcgtatcgatcgcgcagaaggaattcgagcaaatttatccgcagccg
ggctgggtcgagcacgatccccaggagatctggtcgacgcaggcgggcgtcgcggccgag
gccgtcacgcgcgtcggcctgaacggcacggcgatcgccgcgatcggcatcacgaaccag
cgcgagacgacgatcgtctgggatcgcgagacgggtcatccgatctacaacgcgatcgtc
tggcaggatcgccgcaccgccgatttctgcgacaagctcaaggcgcagggcctcagcgag
aaggtgcgcgcgaagacgggcctgccgatcgactcgtacttctcggccaccaagatccgc
tggattctcgacaacgtcgagggcgcgcgcgagaaggcgcgccagggcaagctcgcgttc
ggcacggtcgacagctggctcgtgtggaacttcacgaagcacgagctgcacgtgaccgac
gtgacgaacgcgtcgcgcacgatgctcttcaacatccacacgctcgactgggacgacgag
ttgctcgacgcactcgagattccgcgcagcatgctgccgcaagtgcgcgcgtcctccgag
atctacgggccgacgaagaccaccgtgttcgcctcgaagattccgctcgccggcatcgcg
ggcgatcagcaggccgcgctcttcggccagatgtgcacgagctcgggcatggtgaagaac
acctacggcaccggctgcttcctgatgatgaacaccggcgagacgccgatcgaatcgcgg
aacaacctcgtcacgacgatcgcctggcaagtcgacggcaaggtcagctacgcgctcgaa
ggcagcatcttcatcgcgggcgcggtcgtgcagtggctgcgcgacgggctcggcatcatc
aagagcgcgtcggagatcgaggcgctcgccgccggcgtgccgcacacggacggcgtctat
ctcgtgcccgcgttcgccggcctcggcgcgccgcactggaacgcgcgcgcccgcggctcg
ctgttcggcgtcacgcgcggcacgacgtccgcgcacctcgcgcgcgcggcgctcgattcg
atcgcgtatcaatcgctcgacgtgctcaaggccatggaggccgattcgggcatccgcatc
ggcgagctgcgcgtggacggcggcgcgagcgcgaacaacctgctgatgcagttccaggcg
gatctgctcggcgtcgacgcggtgcgcccgcgcatcaccgagacgaccgcgctcggcgcc
gcgtatctcgcgggcctcgcgatcggctactggcagaacgtcgacgagctgcacagccaa
tggcagctcgagcgccgcttcgcgccttcgatgcaggccgagcaggtgggctcttgcctc
gccggctggcagcgcgcggtgcgcgcggcgaaggcatgggcggacgacacgcagtaa

DBGET integrated database retrieval system