KEGG   Burkholderia mallei SAVP1: BMASAVP1_A3085Help
Entry
BMASAVP1_A3085    CDS       T00457                                 

Gene name
fadA
Definition
(GenBank) acetyl-CoA acetyltransferase family protein
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bmv  Burkholderia mallei SAVP1
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:bmv00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BMASAVP1_A3085 (fadA)
   00630 Glyoxylate and dicarboxylate metabolism
    BMASAVP1_A3085 (fadA)
   00640 Propanoate metabolism
    BMASAVP1_A3085 (fadA)
   00650 Butanoate metabolism
    BMASAVP1_A3085 (fadA)
  Lipid metabolism
   00071 Fatty acid degradation
    BMASAVP1_A3085 (fadA)
   00072 Synthesis and degradation of ketone bodies
    BMASAVP1_A3085 (fadA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BMASAVP1_A3085 (fadA)
   00310 Lysine degradation
    BMASAVP1_A3085 (fadA)
   00380 Tryptophan metabolism
    BMASAVP1_A3085 (fadA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BMASAVP1_A3085 (fadA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BMASAVP1_A3085 (fadA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BMASAVP1_A3085 (fadA)
Enzymes [BR:bmv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BMASAVP1_A3085 (fadA)
Exosome [BR:bmv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BMASAVP1_A3085 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
I:complement(3058186..3059382)
Genome map
AA seq 398 aa AA seqDB search
MTAVDQDPIVIASAARTPIAGFQGEFASLAAPQLGAAAIAAALERAGLQPEQIDEAVMGC
VLPAGQGQAPARQAALGAKLPLSVGCTTINKMCGSGMRAAMFAHDMLVAGSVDVIVAGGM
ESMTNAPYLLPKARAGMRMGHGQVLDHMFLDGLEDAYDKGRLMGTFAEECAGEYAFSRDA
QDAFAIESLARAKRANEDGSFAWEIAPVTVAGKKGDAVIARDEQPFKANPEKIPTLKPAF
SKTGTVTAANSSSISDGAAALVMMRASTANRLGLAPLARVVGHSTFAQAPSKFTTAPVGA
IRRLFEKNGWRAAEVDLYEINEAFAVVTMAAMKEHGLPHEKVNVNGGACALGHPIGASGA
RILVTLIGALRARGQARRGEPVHRRRRSDRDGHRADLT
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgacggctgttgatcaggatccgatcgtcatcgcatcggcggcgcgcacgccgatcgcg
ggctttcagggcgagttcgcgtcgctcgccgcaccgcagctgggcgcggccgcgatcgcc
gcggcgctcgagcgcgcgggcctgcaaccggagcagatcgacgaggcggtgatgggctgc
gtgctgcccgccgggcaggggcaggcgccggcgcggcaggcggcgctcggcgcgaagctg
ccgctgtcggtcggctgcacgacgatcaacaagatgtgcggctcgggcatgcgcgcggcg
atgttcgcgcacgacatgctcgtggcgggctccgtcgacgtgatcgtcgcgggcggcatg
gaaagcatgacgaacgcgccgtacctgctgccgaaggcgcgcgccggcatgcgcatgggc
cacggccaggtgctcgaccacatgttcctcgacggcctcgaggacgcctacgacaagggc
cggctgatgggcacgttcgccgaggaatgcgcgggcgaatacgcgttctcgcgcgacgcg
caggacgcgttcgcgatcgaatcgctcgcgcgcgcgaagcgggcgaacgaggacggctcg
ttcgcgtgggaaatcgcgcccgtgacggtggccggcaagaagggcgatgcggtgatcgcg
cgcgacgagcagccgttcaaggcgaaccccgagaagattccgacgctcaagcccgcgttc
agcaagacgggcaccgtgaccgccgcgaattcgtcgtcgatctccgacggcgcggccgcg
ctcgtgatgatgcgcgcgtcgacggcgaaccggctcgggctcgcgccgctcgcgcgcgtc
gtcggccattcgacgttcgcgcaggcgccgtcgaagttcacgacggcgcctgtcggcgcg
atccggcgcctgttcgagaagaacggctggcgcgcggccgaggtcgacctgtacgagatc
aacgaagcgttcgcggtcgtcacgatggcggcgatgaaggagcacggcctgccgcacgag
aaggtcaacgtgaacggcggcgcgtgcgcgctcggccatccgatcggcgcgtcgggcgcc
cgcatcctcgtcacgctgatcggcgcgctgcgcgcgcggggccaagcgcggcgtggcgag
cctgtgcatcggcggcggcgaagcgaccgcgatgggcatcgagctgatctgacctga

DBGET integrated database retrieval system