KEGG   Burkholderia mallei SAVP1: BMASAVP1_A3237Help
Entry
BMASAVP1_A3237    CDS       T00457                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
bmv  Burkholderia mallei SAVP1
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmv00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BMASAVP1_A3237 (murA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BMASAVP1_A3237 (murA)
Enzymes [BR:bmv01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     BMASAVP1_A3237 (murA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
I:3202450..3203799
Genome map
AA seq 449 aa AA seqDB search
MQVTVNEHDAVECVATATPAGNREAHAHGTDKLAIEGGRRLAGEIAVSGAKNAALPILCA
GLLSAEPVRLDNVPDLKDVRTTLALLGQMGMREETDGARVVLDASRVDNPVAPYELVKTM
RASILVLGPLLARFGYAKVSLPGGCAIGARPVDQHIKGLQAMGAEIHIEHGYIEARAKRL
SGARIVTDMITVTGTENLLMAATLADGETVIENAAREPEVTDLAHLLVAMGAKIDGIGTD
RLVIQGVERLHGATHAVIPDRIEAGTFLCAVAAAGGDVTLTGMRAHILDAVIDKLREAGA
TIDEGVDTLRVRMDGRPSAVAIRTSEYPAFPTDMQAQFMALNAVAQGAAQVTETIFENRF
MHVQELNRLGANIAVDGNTALVTGVPKLSGASVMATDLRASASLVIAGLCAQGETLVERI
YHLDRGYDRMETKLTAVGANVRRISGSEA
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
gtgcaagtcaccgtcaacgaacacgacgccgtcgagtgcgtcgccacggcaaccccggcc
ggcaatcgggaagcgcacgcgcacggtacggacaagctcgcgatcgagggcggccggcgc
ctcgccggcgagatcgccgtgtcgggcgcgaagaacgccgcgctgccgatcctctgcgcg
ggcctgctgagcgccgagccggtgcgcctcgataacgtgccggacctgaaggacgtgcgc
acgacgctcgcgctgctcggccagatgggcatgcgcgaggaaacggacggcgcgcgggtc
gtgctcgacgcgtcgcgcgtcgacaatccggtcgcgccgtacgagctcgtgaagacgatg
cgcgcgtcgatcctcgtgctcggcccgctcctcgcgcgcttcggctacgcgaaggtgtcg
ctgccgggcggctgcgcgatcggcgcgcggcccgtcgaccagcacatcaagggcctgcag
gcgatgggcgccgagatccacatcgagcatggctacatcgaggcgcgcgcgaagcgcctt
tcgggcgcgcgcatcgtcaccgacatgatcaccgtgacgggcaccgagaacctgctgatg
gcggcgacgctcgccgacggcgagacggtgatcgagaacgccgcgcgcgagccggaagtg
acggatctcgcgcatctgctcgtcgcgatgggcgcgaagatcgacgggatcggcaccgac
cggctcgtgatccagggcgtcgagcgcctgcacggcgcgacgcacgcggtgattccggac
cggatcgaggcgggcacgttcctgtgcgcggtcgcggcggcgggcggcgacgtgacgctc
accggcatgcgcgcgcacatcctcgacgcggtgatcgacaagctgcgcgaagcgggcgcg
acgatcgacgaaggcgtcgacacgctgcgcgtgcgcatggacggccggccgagcgcggtc
gcgatccgcacgtccgaatacccggcgttcccgaccgacatgcaggcgcagttcatggcg
ctgaacgcggtggcgcaaggcgccgcgcaggtgaccgagacgatcttcgagaaccgcttc
atgcacgtgcaggaactgaatcgcctcggcgcgaacatcgcggtcgacggcaacacggcg
ctcgtcacgggtgtgccgaagctctcgggcgcgagcgtgatggcgaccgatctgcgcgcg
tcggcgagcctcgtgatcgccggcctttgcgcgcaaggcgagacgctcgtcgagcgcatc
tatcacttggaccgcggctacgaccggatggaaacgaagctgacggccgtcggcgcgaac
gtgcgccgcatttcggggagcgaagcatga

DBGET integrated database retrieval system