KEGG   Burkholderia mallei SAVP1: BMASAVP1_A3239Help
Entry
BMASAVP1_A3239    CDS       T00457                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
bmv  Burkholderia mallei SAVP1
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bmv01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:bmv00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
I:3204494..3205831
Genome map
AA seq 445 aa AA seqDB search
MAIKIRKLDSAGEGFAAELRAVLAFEASEDDAIERAVAQILADVKARGDAAVLDYTNRFD
RLNAASVAALELPQSELEAALEGLEPKRRAALEAAAARVRGYHEKQKIECGSHSWQYTEA
DGTVLGQKVTPLDRVGLYVPGGKAAYPSSVLMNAIPARVAGVGEIVMVVPTPDGLKNDLV
LAAALLGGVDRVFTIGGAQAVAALAYGTQTVPAVDKICGPGNAYVASAKRRVFGTVGIDM
IAGPSEILVLCDGTTDPSWVAMDLFSQAEHDELAQSILLCPDEAFIERVEKAIGELLPTM
PRQDVIRASLEGRGALVKVRDMAEACRIANDIAPEHLEISALEPHQWGKQIRHAGAIFLG
RYTSESLGDYCAGPNHVLPTSRTARFSSPLGVYDFFKRSSLIEVSAEGAHTLGEIASELA
YGEGLQAHAKSAEYRMKGAGDRQKG
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggctatcaagatacgcaaactcgattcggcaggcgaaggcttcgcggccgaattgcgc
gcggtgctcgcgttcgaggcgagcgaagacgacgcgatcgagcgcgcggtcgcgcagatt
ctcgccgacgtgaaggcgcgcggcgacgccgcggtgctcgactacacgaatcgcttcgac
cggctgaacgcggcgagcgtcgcggcgctcgagctgccgcaaagcgagctggaagcggcg
ctcgagggcctcgagccgaagcgccgcgcggcgctcgaagcggcggccgcgcgcgtgcgc
ggctaccacgagaagcagaagatcgagtgcggcagccatagctggcagtacaccgaggcc
gacggcaccgtgctcggccagaaggtgacgccgctcgaccgcgtcggcctgtacgtgccg
ggcggcaaggccgcgtatccgtcgtcggtgctgatgaacgcgattccggcgcgcgtcgcg
ggcgtcggcgagatcgtgatggtcgtgccgacgccggacggcctgaagaacgatctcgtg
ctcgccgcggcgctgttgggcggcgtcgatcgcgtgttcacgatcggcggcgcgcaggcg
gtggccgcgctcgcgtacggcacgcaaacggtgcccgccgtcgacaagatctgcgggccg
ggcaacgcgtacgtcgcgtcggccaagcgccgcgtgttcggcacggtcggcatcgacatg
atcgccgggccgtcggagatcctcgtgctgtgcgacggcacgaccgatccgtcgtgggtc
gcgatggacctgttctcgcaggccgagcacgacgagctcgcgcaatcgatcctgctgtgc
ccggacgaagcgttcatcgagcgcgtcgagaaggcgatcggcgagctgctgccgacgatg
ccgcgccaggacgtgatccgcgcgtcgctcgaggggcgcggcgcgctcgtcaaggtgcgc
gacatggccgaggcgtgcaggatcgcgaacgacatcgcgcccgagcacctggagatctcc
gcgctcgagccgcaccaatggggcaagcagatccgccacgcgggcgcgatcttcctcggc
cgctacacgagcgagagcctgggcgattactgcgcgggcccgaatcacgtgctgccgacg
tcgcgcaccgcgcgcttttcgtcgccgctcggcgtgtacgatttcttcaagcgctcgagc
ctgatcgaggtgagcgccgaaggcgcgcacacgctcggcgagatcgcgtccgagctcgcg
tacggcgaaggtttgcaggcgcacgcgaagagcgccgagtaccggatgaaaggagcgggc
gaccgccagaaaggctaa

DBGET integrated database retrieval system