KEGG   Burkholderia mallei SAVP1: BMASAVP1_A3281Help
Entry
BMASAVP1_A3281    CDS       T00457                                 

Definition
type III restriction-modification system, res subunit (EC:3.1.21.5)
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
bmv  Burkholderia mallei SAVP1
Brite
Enzymes [BR:bmv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     BMASAVP1_A3281
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:3235988..3239017
Genome map
AA seq 1009 aa AA seqDB search
MQLHFESDLDYQLEAIEAVCDLFRSQEACRAEFSVTAQAARRRAGPQISLGMAESGLGVG
NRLTLDAHTFAENLARVQVRNGLPPSGAPSSNDFTVEMETGTGKTYVYLRTIFELHRRFD
FTKFVIVVPSVAIKEGVHKTLQITEQHFRRLYAGVPFDYFVYDSAKLGEVRSFASKSIVQ
IMIVTVAAINKKDVNTLYKDSEHTGGEKPIDLIRATHPIVIVDEPQSVDGGLEGRGKEAL
DAMRPLCTLRYSATHADKYQMLYRLDAIDAYERKLVKQIEIASATVEDAHNKPFVRVISI
GSRRGAIAARVELDVATAAGDVERQTVSVSDGDDLERVARRAVYANFSIGEIHAARGAEY
LVLRYPGGDAFLSVGDAYGDVDTHAIQREMIRRTIREHLDKELRLTPLGVKVLSLFFVDA
VDKYRKYDRHGQPFKGDYALLFEDEYRRAAKLPEYRALFDGVDAGLAAEAVHDGYFSIDK
KGGWTDTSDRSAGSRENAERAYGLIMKDKERLLSFDTPLKFIFSHSALKEGWDNPNVFQI
CTLRDIHSERERRQTIGRGLRLAVNQRGERVRGFDVNTLTVIAGESYEQFAENLQKEIEA
DTGIRFGIVETHQFAALPVPADDGSVQPLGVERSAALWMHLRDAGYLDARGRVQDTLRAA
LKLRALPLPDEFDALRALIVDMLRKLAGRLDVRNADERRHIALRRDAHGEAVYLGDAFRA
LWDRIRHRTTYRVNFDNARLIERCVAALKAAPAVTRARLQWRKADIAIDASGVEATETED
AGAIAIDEGEVELPDLLTELQDRTQLTRRTIAKVLIESGRLDEFPLNPQRFIALVAAALE
RCKRDALVDGIEYRLLGEAQVHALSLFESEPLTGYLSSMRRGAAKSIHEDVPCDTPAERA
FVESLEQDDAVRLYAKLPGWFKIPTPLGSYSPDWAVLIAEGDGPRLYFVVESKSGVADGD
LRADERRRVQCGAAHFRALEAVADNPARYVRARRADDLPTAAADARDAA
NT seq 3030 nt NT seq  +upstreamnt  +downstreamnt
atgcagttgcatttcgagtcggatctcgactatcagctcgaagcgatcgaggcggtatgc
gatctgtttcgcagccaggaggcgtgccgcgccgaattcagcgtcaccgcgcaggccgcg
cggcggcgcgcgggcccgcagatttcgctcgggatggccgaatcggggctcggcgtcggc
aatcgcctgacgcttgatgcgcacacgttcgccgagaatctcgcgcgcgtgcaggtgcgc
aacggcctgccgccgtccggcgcacccagctcgaacgatttcaccgtcgagatggaaacg
ggcacgggcaagacctacgtgtacctgcgcacgatcttcgagctgcaccgccgcttcgac
ttcacgaagttcgtgatcgtcgtgccgtcggtcgcgatcaaggagggggtgcacaagacg
ctgcagatcaccgagcagcatttccggcgcctttacgcgggcgtgccgttcgactatttc
gtctacgattcggcgaagctcggcgaggtgcgcagcttcgcgtcgaaatcgatcgtgcag
atcatgatcgtcacggtcgcggcgatcaacaagaaggacgtcaacacgctctacaaggac
agcgaacatacgggcggcgagaagccgatcgacctgattcgcgcgacgcacccgatcgtg
atcgtcgacgagccgcagagcgtggacggcgggctcgaggggcgcggcaaggaggcgctc
gacgcgatgcgcccgctctgcacgctgcgctactcggcgacgcacgcggacaagtatcag
atgctgtaccggctcgacgcgatcgacgcttacgagcgcaagctcgtcaagcagatcgag
atcgcgtcggcgaccgtcgaggacgcgcacaacaagccgttcgtgcgcgtgatatcgatc
ggcagccggcgcggcgcgatcgccgcgcgcgtcgagctcgacgtcgcgacggctgcgggc
gatgtcgagcggcagacggtttccgtctccgacggcgacgatctggaacgcgtggcgcgt
cgcgccgtctatgcgaatttttcgatcggcgagattcacgcggcgcgcggcgccgaatat
ctggtgctgcgctatccgggcggcgacgcgttcctgtcggtcggcgacgcatacggcgac
gtcgatacgcacgcgatccagcgcgagatgatccgccgcacgatccgcgagcatctcgac
aaggagctgcgcctcaccccgctcggcgtgaaggtgctgtcgctcttcttcgtcgacgcg
gtcgacaagtatcgcaagtacgaccgccacggccagccgttcaagggcgactacgcgctg
ctgttcgaagacgaataccggcgcgcggcgaagctgcccgaatatcgcgcgctgttcgac
ggcgtcgacgcgggcctcgcggccgaggcggtgcacgacggctatttctcgatcgacaag
aaaggcggctggaccgacacgagcgaccggagcgccggcagccgggagaatgcggagcgc
gcgtacgggctcatcatgaaggacaaggagcggctgctgtcgttcgacacgccgctgaag
ttcatcttctcgcactcggcgctgaaggaaggctgggacaatccgaacgtgttccagatc
tgcacgctgcgcgacatccacagcgagcgcgagcgccgccagacgatcggccgcgggctg
cgtctcgccgtcaaccagcgcggcgagcgcgtgcgcggtttcgacgtcaatacgctgacg
gtgatcgcgggcgaaagctacgagcagttcgccgagaatctgcaaaaggagatcgaagcc
gatacggggatccgcttcggcatcgtcgagacgcaccagttcgccgcgctgccggtgccg
gccgacgacggcagcgtgcagccgctcggcgtcgaacgctccgccgcgctgtggatgcat
ctgcgcgacgccggctatctcgacgcgcgcggccgcgtgcaggacacgctgcgcgcggcg
ctcaagctgcgcgcgttgccgctgcccgacgagttcgacgcgctgcgcgcgctgatcgtc
gacatgctgcgcaagctggcgggccggctcgacgtgcgcaacgcggacgagcgccgccac
atcgcgctgcggcgcgacgcgcacggcgaggcggtgtacctgggcgacgcattccgcgcg
ctgtgggaccgcatccggcaccgcacgacgtaccgcgtgaacttcgacaacgcgcgcctg
atcgagcgctgcgtcgccgcgctgaaggcggcgcccgccgtcacgcgcgcgcggctgcag
tggcgcaaggccgatatcgcgatcgacgcgtcgggcgtcgaggcgaccgaaaccgaggat
gcgggcgcgatcgcgatcgacgaaggcgaggtcgagctgccggatctgctgaccgagctg
caggaccgcacgcagctcacgcgccgcacgatcgcgaaagtgctgatcgaaagcggccgg
ctcgacgagttcccgctcaatccgcagcgcttcatcgcgctcgtcgccgcggcgctcgag
cgttgcaagcgcgacgcgctcgtcgacgggatcgagtacaggctgctcggcgaagcgcag
gtgcacgcgctttcgctgttcgagagcgagccgctcaccggctatctgtcgagcatgcgg
cgcggcgcggcgaaatcgattcacgaggacgtgccgtgcgacacgcccgccgagcgcgcg
ttcgtcgaatcgctcgaacaggacgacgcggtcaggctgtacgcgaagctgcccggctgg
ttcaagattccgacgccgcttggcagctacagccccgactgggcggtgctgatcgccgaa
ggcgacgggccgcggctctatttcgtcgtcgaatcgaagagcggcgtcgccgacggcgat
ctgcgcgctgacgagcggcgcagggtccagtgcggcgccgcgcatttccgcgcgctggag
gcggtggcggacaaccccgcgcgctacgtgcgcgcgcgccgcgccgacgatctgccgacg
gccgccgccgacgcgcgcgatgcggcctga

DBGET integrated database retrieval system