KEGG   Burkholderia mallei SAVP1: BMASAVP1_A3290Help
Entry
BMASAVP1_A3290    CDS       T00457                                 

Definition
phenylacetaldehyde dehydrogenase (EC:1.2.1.39)
Orthology
K00146  
phenylacetaldehyde dehydrogenase [EC:1.2.1.39]
Organism
bmv  Burkholderia mallei SAVP1
Pathway
Phenylalanine metabolism
Styrene degradation
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Amino acid metabolism; Phenylalanine metabolism [PATH:bmv00360]
Metabolism; Xenobiotics biodegradation and metabolism; Styrene degradation [PATH:bmv00643]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
I:complement(3247365..3248870)
Genome map
AA seq 501 aa AA seqDB search
MNLAALSTQHQRQSGFLARRQFGNWIDGRAAEPRSGRYLPVVDPATEMTIAEVAASDARD
VDAAVAAARRAFDSGDWPRMRPASREKLLHQLAERLERYADELAALETLETGKLIGVARA
IDVLGGAEYVRYMAGWATKLEGSTLDTSIAAPAGAEYFAYTRREAVGVVGAIVPWNFPLA
IALWKVATALACGCTVVLKPSEETPLTALRLGELAQEAGLPDGVLNIVTGAGAEAGAALA
AHPGIDKITFTGSVGVGRAIGHAAVERMARFTLELGGKSPLIVLDDADPDFAAHGAAQGI
FFNQGQVCTAGSRVYVQKRLFERVVAGIAAAAEAMKIGSGFDPNTQIGPLVSKRHFERVL
GHVDAAKEEGATLVTGGTRALDGGYFVKPTVFVDAAPAMRIVREEVFGPVVTVTPFDTVD
DAVRLANDTDFGLAASVWSQNLSHVHRVVPRLKAGIVWVNTHNMLDPNLPFGGFKQSGYG
RELGRAALEQFTELKSVCIAH
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaacctggccgctctttcgacccagcatcaacgccaatccggctttctcgcccgccgc
cagttcggcaactggatcgacggccgcgccgccgagccgcgctcgggccgctatctgccc
gtcgtcgatccggcgaccgagatgacgatcgcggaagtcgccgcgagcgacgcgcgcgat
gtcgacgcggccgtggccgccgcgcgccgcgcgttcgattcgggcgactggccgcgcatg
cggcccgcgagccgcgaaaagctgctgcatcagctcgccgagcgcctcgagcgctacgcg
gacgagctcgccgcgctcgagacgctcgaaaccggcaagctgatcggcgtcgcgcgcgcg
atcgacgtgctgggcggcgccgagtacgtccgctacatggccggttgggcgacgaagctc
gaaggctcgacgctcgatacatcgatcgccgcgcccgccggcgccgagtatttcgcgtat
acgcgccgcgaggcggtgggcgtcgtcggcgcgatcgtgccgtggaattttccgctcgcg
atcgcgttgtggaaggtcgcgaccgcgctcgcatgcggctgcacggtggtgctgaagccg
tcggaggaaacgccgctcaccgcgctgcgcctgggcgagctcgcgcaggaagcggggctg
cccgacggcgtgctgaacatcgtgacgggcgcgggcgccgaggcgggcgcggcgctcgcc
gcgcatccgggcatcgacaagatcaccttcacgggctcggtcggcgtgggccgcgcgatc
ggccacgcggccgtcgagcggatggcgcgcttcacgctcgagctcggcgggaaatcgccg
ctgatcgtcttggacgatgccgaccccgacttcgccgcgcatggcgcggcgcaaggcatc
ttcttcaatcaggggcaggtctgcacggcgggctcgcgcgtgtacgtgcaaaagcgcctg
ttcgagcgggtcgtcgccggcatcgccgcggccgccgaagcgatgaagatcggctcgggc
ttcgatccgaacacgcagatcggcccgctcgtgtcgaagcggcacttcgagcgcgtgctc
ggccacgtcgacgccgcgaaggaggagggcgcgacgctcgtcaccggcggcacgcgcgcg
ctcgacggcggctatttcgtgaagccgacggtgttcgtcgacgccgcgcctgcgatgcgg
atcgtgcgcgaggaggtgttcgggccggtcgtcacggtcacgccgttcgacacggtcgac
gacgcggtgcggctcgcgaacgacaccgacttcgggctcgcggcgagcgtgtggtcgcag
aacctgtcgcacgtgcatcgcgtcgtgccgcggctgaaggcgggcatcgtctgggtgaac
acgcacaacatgctcgatcccaacctgccgttcggcggcttcaagcaatcgggctacggc
cgcgagctcggccgcgcggcgctcgaacagttcaccgagctcaaatccgtctgcatcgcg
cattga

DBGET integrated database retrieval system