KEGG   Brucella melitensis NI: BMNI_I0031Help
Entry
BMNI_I0031        CDS       T01853                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bmw  Brucella melitensis NI
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bmw00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BMNI_I0031
DNA repair and recombination proteins [BR:bmw03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BMNI_I0031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(37647..38252)
Genome map
AA seq 201 aa AA seqDB search
MSKRIAGPEIERLIQLLARVPGLGPRSARRAALHLIKKKEALLVPLGGAMQEAAEKVRIC
SCCGNVDTSDPCTICTDERRDPATLIVVEDVSDLWALERADTMNVRYHVLGGRLSPLDGI
GPDDLNIKGLVERVASGAIKEVILAVNATVEGQTTAHYITDQLSNFDMRVTRLAHGVPVG
GELDYLDEGTLAAALRARTTL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaacgaatagccggtcctgaaatcgaacgtctgatccagcttctggcccgcgtg
ccggggctcggaccgcgctcggcccgccgtgcggcgctgcatctcatcaaaaagaaggaa
gcgcttctggtgccgcttggcggcgccatgcaggaggccgctgaaaaggtgcgcatctgt
tcgtgttgcggcaatgtcgatacgtccgacccgtgcacgatctgcaccgatgagcgccgc
gatccggcaactttgattgtcgtggaggacgtatccgatctctgggcgctggagcgggca
gacacaatgaatgtgcgctatcatgtattgggtggccgcctgtcaccgctcgatggcatc
ggcccggacgatctcaacatcaaggggctggtggagcgggttgcaagcggcgccatcaag
gaagtgatcctcgcggtcaacgccactgtcgaaggccagacgaccgcccattacatcaca
gaccagctatcgaatttcgatatgcgcgtgacacggcttgcccatggcgttcccgttggc
ggcgaacttgactatctggatgaaggcacgcttgctgctgcgttacgggcgcgaaccacg
ctttaa

DBGET integrated database retrieval system