KEGG   Brucella melitensis NI: BMNI_I0038Help
Entry
BMNI_I0038        CDS       T01853                                 

Definition
cytochrome C
Orthology
K08738  
cytochrome c
Organism
bmw  Brucella melitensis NI
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:bmw00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    BMNI_I0038
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BMNI_I0038
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:44317..44895
Genome map
AA seq 192 aa AA seqDB search
MAFLATVFVVMTTGILSDSLFHSPAPEKPGFAIEVAQGSGGGESAAPPAKEEVSIATLLQ
SADPARGEVVFKRCQACHTGDKGGANKVGPHLWGVVGRPAASVEGFSYSAAMKEFGAAGN
KWDFEHLNKFLTSPKGFIKGTAMGFAGDKKDNERADLIAYLRTLSDNPVPLPAADAAPAD
SDKKPAEAAPAN
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggcatttctggcaacggttttcgttgtcatgacgacgggcattctgtctgattcgctg
tttcattcgccggctcctgaaaagccgggctttgccatagaggtagcccaaggttcgggg
ggcggagaaagtgctgcgcctcccgccaaggaagaagtttcaattgcaaccctgttgcaa
agtgccgatccggcgcgtggcgaagtggttttcaagcgttgccaggcttgccacaccggg
gacaagggcggggccaacaaggttggtccgcatctgtggggtgtcgtgggtcgcccggct
gcctccgttgaaggtttcagctattccgctgccatgaaggaattcggcgcggctggcaac
aagtgggattttgagcatctcaacaagttcctcacctcgccgaaaggcttcatcaagggt
acagccatgggctttgccggtgacaagaaggataatgagcgcgctgacctgattgcttat
ctgcgcacgctgtccgacaatccggtgccgctgccggccgcagacgcagcgcccgcagat
agcgataaaaagcccgccgaagctgcaccggccaattga

DBGET integrated database retrieval system