KEGG   Brucella melitensis NI: BMNI_I0083Help
Entry
BMNI_I0083        CDS       T01853                                 

Definition
Arylesterase precursor
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
bmw  Brucella melitensis NI
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:bmw01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(89677..90402)
Genome map
AA seq 241 aa AA seqDB search
MMRFKLQIPAAAMLKALLVSLLALFVAAASASAQEEPTGLEDALPTEQLSQVKIVGFGDS
LMAGYLLPSNAAFPQQLEKALNDKGYEVTVENAGVSGDTTTGGLSRIDWSIPDGTNLVIL
ELGANDALRGIQPDITEKNLDEMLAKLKARGISVILAGMVAPPNMGKDYAGKFNPIYPRL
ARKYDVPLYPFFLDGVATRKGLLLEDGMHPNEKGVETIVANFMPSVEKALKNLQNTGTSG
G
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgtttcaaactccaaattcccgcagccgcgatgctcaaggcgcttctggtttcg
cttttggcactttttgtcgcggccgcaagtgcaagcgcgcaagaagaaccgacaggcctt
gaagatgcgctgcccaccgaacagctctcgcaggtgaagatcgtgggcttcggcgacagc
ctcatggctggctatcttctgccgtcgaatgccgcctttccacagcagcttgaaaaggcg
ctcaacgacaagggctacgaggtgacggtcgaaaatgcgggcgtatcgggcgacaccacg
accggcgggctttcgcgtatcgactggtccattcccgatggtaccaatctggtgatcctg
gaacttggcgcaaacgatgcgctgcgcggcatccagccggatatcacggaaaagaatctc
gatgaaatgctggcaaagctgaaggcgcgcggcatttccgtcatccttgcaggcatggtt
gcccctcccaatatgggaaaagactatgcaggcaaattcaacccgatctatcccaggctg
gcgcgcaaatatgatgtgccgctctacccgttcttcctcgacggtgtagcaaccaggaaa
ggacttttgctcgaggacggaatgcatcccaatgaaaagggtgtcgaaacgatcgtggcc
aatttcatgccgtcggtcgaaaaggcgctcaagaatttgcaaaacacggggacatcgggc
ggatga

DBGET integrated database retrieval system