KEGG   Brucella melitensis NI: BMNI_I0476Help
Entry
BMNI_I0476        CDS       T01853                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
bmw  Brucella melitensis NI
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bmw00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:483104..483721
Genome map
AA seq 205 aa AA seqDB search
MVVISSPSGAGKSTIARLLLEDPKMKLSLSISVTTRQRRPSEIDGVHYHFITIREFERLR
DNDELIEWAEVHGNFYGTLRETAEIALADGQDMLFDIDWQGADQLQAKMPADVVSIFILP
PTMRELQQRLNRRAEDTAEVIETRLQNARFEIQKWVKYDYIVINEDLDRSYAAIKSIINA
ERLRRDRRPGLFDFVTGLLEEDPGM
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggtggtgatctcgtcgccgtcgggtgcgggaaaatccaccattgcccggctgcttctg
gaagacccgaagatgaagctctcgctctccatcagtgtgacgacgcgccagcgtcgcccg
agcgagattgacggcgtacattatcatttcatcacgatccgcgaattcgagcgcctgcgc
gacaatgacgagctgatcgaatgggccgaagtgcacggcaatttttatggtacgctgcgc
gaaacggccgagattgcgctggccgatgggcaggacatgctgttcgatatcgattggcag
ggggcggaccaattgcaggccaagatgccagccgatgtggtgtcgatcttcatcctgccg
ccgaccatgcgcgaattgcagcagcgtctcaaccggcgcgccgaagacacggcggaagtg
atcgaaacgcgcctgcagaatgcgcgctttgaaatccagaaatgggtgaaatacgactat
attgtcatcaatgaagacctcgaccgttcctatgcggcgatcaagtcgatcatcaatgcg
gagcggctgcgccgtgaccgccgccccggcctgtttgattttgtcacggggcttctggag
gaagatccggggatgtga

DBGET integrated database retrieval system