KEGG   Brucella melitensis NI: BMNI_I0844Help
Entry
BMNI_I0844        CDS       T01853                                 

Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
bmw  Brucella melitensis NI
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bmw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMNI_I0844
   00052 Galactose metabolism
    BMNI_I0844
Enzymes [BR:bmw01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     BMNI_I0844
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:848989..850011
Genome map
AA seq 340 aa AA seqDB search
MNSEIFGYAPDGQVVHRLTISNGPLTAKIINWGAAIQDLRMEGHPAPLVIGYRDFADYPA
HSPHLGAIAGRSANRIRNARFDLDGTVYEVEPNFCGRHNLHGGSKGLGHHVWKITATGPD
FVSLATVSPDGEMGFPGNLNVNCTYMLNADGTLIVRLEAVTDRPTICNLLHHSYFNLDDG
GEGDVLDHQFKIAGDAYLPVDEALIPDGRVLPVKDTAFDFREFRPLRMQENGRQVAYDNN
FCLAAARGPLRPCASVKAARSGIRLDISTTEPGIQLYAGNTMANDCIGLTGKPYGKHAGF
CLEPQIWPGALEYPYFPQPILRPGDIYAQTSHFTFSREED
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtgaattcggaaatcttcggctatgcgccggacgggcaggtggtccaccgcctcactatc
tccaacgggcctttgaccgcaaagatcatcaattggggcgcagccattcaggatctgcgt
atggaaggccacccggcgccactggtgatcggctatcgcgattttgccgattatccggca
cattccccgcatctgggtgcgattgcgggccgctcggccaaccgtatccgcaatgcgcgc
tttgatcttgatggaacggtttacgaggtggagccgaacttctgtggccgccacaatctg
catggcggcagcaaggggctcggacaccatgtctggaagatcacggcgaccggccctgat
ttcgtgtcgcttgcaacggtttctcccgatggcgagatgggcttccccggcaatctgaat
gtgaattgcacctatatgctcaatgcggatggaacgctgattgttcggctggaggctgtg
accgacaggccaaccatatgcaatctgcttcaccacagctatttcaatctggatgacggt
ggtgagggtgatgttctcgaccaccaattcaagattgcaggcgacgcctatcttccggtg
gatgaggcgcttattccggacgggcgggttctgccggtaaaggacacggctttcgatttc
cgcgaattcaggccgcttcgtatgcaggaaaacggccgtcaggtggcgtatgacaataat
ttctgccttgcggctgcacgcggcccgctgcgcccctgcgcttcggtaaaggccgcgcgg
tccggcatccggcttgatatttcaactaccgaaccggggatacagctctatgctggcaac
accatggccaatgattgcataggactgacgggcaagccctatggcaaacatgctggcttt
tgccttgaaccacagatatggccgggcgcgctggaatatccttattttccgcagccgatc
ctgcgcccgggcgatatttacgcacagaccagccattttaccttttcgcgcgaggaggat
taa

DBGET integrated database retrieval system