KEGG   Brucella melitensis NI: BMNI_I0927Help
Entry
BMNI_I0927        CDS       T01853                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bmw  Brucella melitensis NI
Brite
Enzymes [BR:bmw01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     BMNI_I0927
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:933268..933936
Genome map
AA seq 222 aa AA seqDB search
MVADFQDLRTKMVDNQIRTTDVTDLAVIDAFLTVPREAFVPASRQALAYIDEDQLLESEG
PAPRYIMEPSPFAKLVQLARVSKSDVVLDIGCASGYSAAVLSQLAGSVIGLESDSSLAAA
ATARLQEFGYDNVVIVSGELRAGYPSEAPYDVIFIEGAVDFVPDVLFNQLKEGGRLVAVE
GRGNAGVARLYVKESGVASGRTVFNAAIKPLPGFECEEQFEF
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggtagccgatttccaggatcttcgcacaaagatggtcgataaccagatccgcacgacg
gacgtgactgatctggcggttatcgatgcgtttctgaccgttccgcgcgaggcattcgtt
ccggcaagccgtcaggctctggcctatatcgatgaagatcagcttctggaaagcgaaggc
ccggccccgcgttatatcatggagccttcgcccttcgccaagcttgtgcagcttgcccgt
gtcagcaagagcgatgtcgttctcgatatcggctgcgcatccggctattcggcggctgtc
ctttcccaattggctggatcggtcatcggtttggaaagcgattcctcgcttgcagccgcc
gcaacggcgcgtcttcaggaattcggttatgacaacgttgtgatcgtttcgggcgagttg
agggcaggctatccgtccgaagcaccctatgatgttattttcatcgaaggtgcagttgat
ttcgtcccggacgttctgttcaatcagctcaaggaaggcggtcgcctggttgcggtcgaa
ggccgtggaaatgcgggcgttgcgcgtctttacgtcaaggaaagcggcgtggcttccggg
cgtaccgttttcaatgcagcgatcaaaccgctccccggtttcgagtgtgaagagcagttc
gaattttaa

DBGET integrated database retrieval system