KEGG   Brucella melitensis NI: BMNI_I1006Help
Entry
BMNI_I1006        CDS       T01853                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
bmw  Brucella melitensis NI
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bmw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BMNI_I1006
Enzymes [BR:bmw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     BMNI_I1006
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1012129..1012641
Genome map
AA seq 170 aa AA seqDB search
MRAWLGLGGNIDDPIISMASALRMLDGRSDTRVVSVSPVYRTPPWGKTDQAWFHNACAQI
ETALQPLELIAVCLDVERSLKRVRLERWGPRIIDIDILVMQDETGRAITMQEPALELPHP
RMHERAFVLAPLNDIAPSLPVGARTVAEWAADCDRAEMEKARTDAGWWLE
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
ttgcgcgcctggcttggcctcggcggcaatatcgatgatccgatcatctccatggcgagc
gcgcttcgtatgctggatggacggagcgacacgagggttgtttccgtatccccggtctac
cggaccccgccatggggcaagacggatcaggcctggttccacaatgcctgcgcgcaaatc
gaaacggccttgcagccactggaactgattgcggtctgtctggacgtggagcgatccttg
aaacgtgtgcggctggaacggtggggaccacgcatcatcgatatcgatattcttgttatg
caggatgagacgggcagggcaatcacgatgcaggaaccggcattggagcttccgcatcca
cgtatgcacgagcgagccttcgttctggcgccgctcaatgatatcgcaccttcgctgcct
gtcggtgcgagaactgttgctgaatgggctgccgattgcgaccgtgcggaaatggaaaaa
gcccgcacggatgcgggctggtggttggaatag

DBGET integrated database retrieval system