KEGG   Brucella melitensis NI: BMNI_I1415Help
Entry
BMNI_I1415        CDS       T01853                                 

Definition
pyrazinamidase / nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
bmw  Brucella melitensis NI
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BMNI_I1415
Enzymes [BR:bmw01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     BMNI_I1415
    3.5.1.-  
     BMNI_I1415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1437641..1438300
Genome map
AA seq 219 aa AA seqDB search
MLGNNKAEHPMIGHALVVIDVQNDFCPGGALAVERGDEIIPIVNRLIGESENVVVTQDWH
PANHSSFASNHSGSRPFDTVNMSYGPQVLWPDHCVQNSEGAEFHPDLQWWRAQLVVRKGF
RIGIDSYSAFFENDHCTPTGLGGYLRERNIGSLTMVGLATDFCVASSALDAVQQGFQVRV
RLDACRGIDLNGSMNIMLEKMKQAGVELIDEPVSASHLL
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
ttgctcggcaacaacaaagcggagcatcccatgatcggccatgcacttgtggttatcgac
gtccagaatgatttttgccccggcggcgccttggccgtcgaacgtggcgatgaaatcatc
ccgatcgtcaaccgcctgatcggggaaagcgaaaatgtcgtggtcacgcaggattggcat
ccggccaaccattccagcttcgcctccaaccactccggcagccgcccgttcgatacggtc
aatatgtcttatgggccgcaggtgctctggccggatcattgcgtgcaaaatagcgagggg
gcagaatttcaccccgatctgcaatggtggcgtgcacagcttgtcgtccgcaagggtttc
cgcattggtatcgacagctactccgcattttttgaaaatgaccattgcacgccgacgggc
cttggcggatatttgcgtgaacgcaatatcggatcattgacaatggttggcctcgccacc
gatttctgcgtcgccagttcagcgcttgatgcggtccagcagggctttcaggtgcgggtg
cgactcgatgcctgccgcggtattgatctcaacgggtcgatgaacatcatgctggagaaa
atgaaacaggctggcgtcgaactgatcgatgagcctgtttcagcgtcgcatctactctag

DBGET integrated database retrieval system