KEGG   Brucella melitensis NI: BMNI_I1621Help
Entry
BMNI_I1621        CDS       T01853                                 

Definition
(GenBank) D-3-phosphoglycerate dehydrogenase
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Organism
bmw  Brucella melitensis NI
Pathway
bmw00260  Glycine, serine and threonine metabolism
bmw00680  Methane metabolism
bmw01100  Metabolic pathways
bmw01120  Microbial metabolism in diverse environments
bmw01130  Biosynthesis of antibiotics
bmw01200  Carbon metabolism
bmw01230  Biosynthesis of amino acids
Module
bmw_M00020  Serine biosynthesis, glycerate-3P => serine
Brite
KEGG Orthology (KO) [BR:bmw00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    BMNI_I1621
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BMNI_I1621
Enzymes [BR:bmw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     BMNI_I1621
    1.1.1.399  2-oxoglutarate reductase
     BMNI_I1621
Exosome [BR:bmw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BMNI_I1621
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh ACT AdoHcyase_NAD IlvN UPF0020
Motif
Other DBs
NCBI-ProteinID: AEQ09240
Position
I:complement(1642863..1644464)
Genome map
AA seq 533 aa AA seqDB search
MAPRVLVSDKLSPTAVQIFKDRGVDVDYLPDLGKDKEKLLEVIGEYDGLAIRSATKVTEK
LIAAAKKLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP
EADTSTRAGKWEKNRFMGVEITGKTLGVVGCGNIGSIVATRGIGLKMHVVAFDPFLSDAR
AQELGVEKVELDELLARADFITLHTPLIDKTRNIINAQTLAKMKPGVRIVNCARGGLIVE
KDLIAALKSGHVAGAGIDVYETEPATENELFSLPNVVCTPHLGASTSEAQENVALQVAEQ
MSDYLVKGAVSNAINMPSITAEEAPRLKPFVKLADVLGAFVGQVTDEPIQEVEVLFDGST
ASMNTRALLSAALAGLIRSQVADVNMVSAPIMVKERGIIVSEVKRDKSGIFDGYIKLTVK
TTVRERSIAGTCFSDGKPRFIQIKGINLDAEVGPHMLYVTNKDVPGMIGLLGTICGKHDV
NIANFALGRDHPGGDAIAMLYVDEQIPQAALDELMAQEAIRAATPLEFNVGEV
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggcacctcgcgttctcgtatccgataagctttcgcccactgccgtccagattttcaag
gatcgcggcgtggacgtcgattacctgcccgatctcggcaaggacaaggaaaagcttctc
gaagtcatcggcgaatatgacggtctggcgattcgttcggccaccaaggtcacggaaaag
ctgatcgcagccgcaaagaagctgaaagtcgttggtcgcgccggtatcggcgtcgacaat
gtcgatattccggccgcttcgcgccgcggtatcatcgtcatgaatacgccgttcggcaat
tcgatcaccaccgccgaacacgctattgcgctgatgttcgctgtcgcccgccaattgccg
gaggccgacacctccacccgcgctggcaagtgggaaaagaaccgcttcatgggcgtggaa
atcaccggcaagacgctgggtgtcgttggctgcggcaatatcggctcaatcgtcgccaca
cgcggcataggcctgaaaatgcatgtggtggctttcgatccgttcctttcggatgcgcgc
gcgcaggaactgggcgttgaaaaggtcgagctggatgaattgctggcgcgcgccgatttc
atcacgctccacacgccgctcatcgacaagacccgcaatattatcaatgcgcaaacgctg
gcgaaaatgaaaccgggtgtgcgcattgtcaattgcgcgcgcggtggcctgatcgtggaa
aaggatctgattgcggcgctgaaatccggccatgtggcgggtgctggcattgacgtctat
gaaaccgagcctgcaacggaaaacgagcttttttctctgcccaatgtggtctgcacgccg
catctgggggcatcgacttcggaagcacaggaaaatgtcgcacttcaggtggccgaacag
atgtcggactatcttgtgaagggcgctgtctccaacgccatcaacatgccctcgatcacg
gcggaagaagcgccgcgcctgaagccgttcgtgaagcttgccgatgtgctgggcgctttt
gtcggtcaggtcacggatgagccgatccaggaagtggaagtgcttttcgacggttccacc
gcctcgatgaatacgcgtgcactgctcagtgctgctctggccggtctcatccgttcgcag
gttgccgacgtcaacatggtttccgcgccaatcatggtgaaggagcgcggcatcatcgtc
tcggaagtcaagcgcgacaagtccggcatttttgacggctatatcaagctgacggtgaag
accaccgtgcgcgaacgctccattgcgggcacctgtttctccgatggcaagccgcgtttt
atccagatcaagggaatcaatctcgacgccgaggtcggcccgcatatgctttatgtcacc
aacaaggacgttccgggcatgatcggccttcttggcacgatatgcggcaaacatgatgta
aatattgcgaatttcgcgctcgggcgcgaccatccgggtggcgatgcaatcgcaatgctt
tatgtggatgaacagattccacaggcagcccttgacgaactgatggctcaggaggcaatc
agggcggcgacaccgcttgagttcaacgtcggggaagtttga

DBGET integrated database retrieval system