KEGG   Brucella melitensis NI: BMNI_I1621Help
Entry
BMNI_I1621        CDS       T01853                                 

Definition
D-3-phosphoglycerate dehydrogenase
Orthology
K00058  
D-3-phosphoglycerate dehydrogenase [EC:1.1.1.95]
Organism
bmw  Brucella melitensis NI
Pathway
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Serine biosynthesis, glycerate-3P => serine
Brite
KEGG Orthology (KO) [BR:bmw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BMNI_I1621
   01230 Biosynthesis of amino acids
    BMNI_I1621
  Energy metabolism
   00680 Methane metabolism
    BMNI_I1621
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BMNI_I1621
Enzymes [BR:bmw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     BMNI_I1621
Exosome [BR:bmw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BMNI_I1621
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1642863..1644464)
Genome map
AA seq 533 aa AA seqDB search
MAPRVLVSDKLSPTAVQIFKDRGVDVDYLPDLGKDKEKLLEVIGEYDGLAIRSATKVTEK
LIAAAKKLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLP
EADTSTRAGKWEKNRFMGVEITGKTLGVVGCGNIGSIVATRGIGLKMHVVAFDPFLSDAR
AQELGVEKVELDELLARADFITLHTPLIDKTRNIINAQTLAKMKPGVRIVNCARGGLIVE
KDLIAALKSGHVAGAGIDVYETEPATENELFSLPNVVCTPHLGASTSEAQENVALQVAEQ
MSDYLVKGAVSNAINMPSITAEEAPRLKPFVKLADVLGAFVGQVTDEPIQEVEVLFDGST
ASMNTRALLSAALAGLIRSQVADVNMVSAPIMVKERGIIVSEVKRDKSGIFDGYIKLTVK
TTVRERSIAGTCFSDGKPRFIQIKGINLDAEVGPHMLYVTNKDVPGMIGLLGTICGKHDV
NIANFALGRDHPGGDAIAMLYVDEQIPQAALDELMAQEAIRAATPLEFNVGEV
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggcacctcgcgttctcgtatccgataagctttcgcccactgccgtccagattttcaag
gatcgcggcgtggacgtcgattacctgcccgatctcggcaaggacaaggaaaagcttctc
gaagtcatcggcgaatatgacggtctggcgattcgttcggccaccaaggtcacggaaaag
ctgatcgcagccgcaaagaagctgaaagtcgttggtcgcgccggtatcggcgtcgacaat
gtcgatattccggccgcttcgcgccgcggtatcatcgtcatgaatacgccgttcggcaat
tcgatcaccaccgccgaacacgctattgcgctgatgttcgctgtcgcccgccaattgccg
gaggccgacacctccacccgcgctggcaagtgggaaaagaaccgcttcatgggcgtggaa
atcaccggcaagacgctgggtgtcgttggctgcggcaatatcggctcaatcgtcgccaca
cgcggcataggcctgaaaatgcatgtggtggctttcgatccgttcctttcggatgcgcgc
gcgcaggaactgggcgttgaaaaggtcgagctggatgaattgctggcgcgcgccgatttc
atcacgctccacacgccgctcatcgacaagacccgcaatattatcaatgcgcaaacgctg
gcgaaaatgaaaccgggtgtgcgcattgtcaattgcgcgcgcggtggcctgatcgtggaa
aaggatctgattgcggcgctgaaatccggccatgtggcgggtgctggcattgacgtctat
gaaaccgagcctgcaacggaaaacgagcttttttctctgcccaatgtggtctgcacgccg
catctgggggcatcgacttcggaagcacaggaaaatgtcgcacttcaggtggccgaacag
atgtcggactatcttgtgaagggcgctgtctccaacgccatcaacatgccctcgatcacg
gcggaagaagcgccgcgcctgaagccgttcgtgaagcttgccgatgtgctgggcgctttt
gtcggtcaggtcacggatgagccgatccaggaagtggaagtgcttttcgacggttccacc
gcctcgatgaatacgcgtgcactgctcagtgctgctctggccggtctcatccgttcgcag
gttgccgacgtcaacatggtttccgcgccaatcatggtgaaggagcgcggcatcatcgtc
tcggaagtcaagcgcgacaagtccggcatttttgacggctatatcaagctgacggtgaag
accaccgtgcgcgaacgctccattgcgggcacctgtttctccgatggcaagccgcgtttt
atccagatcaagggaatcaatctcgacgccgaggtcggcccgcatatgctttatgtcacc
aacaaggacgttccgggcatgatcggccttcttggcacgatatgcggcaaacatgatgta
aatattgcgaatttcgcgctcgggcgcgaccatccgggtggcgatgcaatcgcaatgctt
tatgtggatgaacagattccacaggcagcccttgacgaactgatggctcaggaggcaatc
agggcggcgacaccgcttgagttcaacgtcggggaagtttga

DBGET integrated database retrieval system