KEGG   Brucella melitensis NI: BMNI_I1704Help
Entry
BMNI_I1704        CDS       T01853                                 

Definition
D-beta-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bmw  Brucella melitensis NI
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmw00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    BMNI_I1704
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    BMNI_I1704
Enzymes [BR:bmw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     BMNI_I1704
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1722485..1723126
Genome map
AA seq 213 aa AA seqDB search
MLAEEHGANVIYIAADMSKAEDCRNLIAKTVKVFGNSDILVNNAGIQHVAPVEEFPPEQW
DRIIAINLTSAFHTSAAAIPHMRKAGWGRIINIASAHGLVASPFKSAYVAAKHGIVGFTK
TLALELATAKITANSICPGYVLTPLVEAQIPDQMKAHHMDRETVIRDVMLDKQPTKEFVT
TAQIGAVATFLASDAAAQINGAAISVDGGWTAE
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgcttgccgaagaacatggtgcgaatgtcatctatattgccgcggatatgtcgaaagcc
gaagattgccgcaatctcattgccaaaaccgtcaaggttttcggcaactccgatattctg
gtcaataatgcgggcatccagcatgtcgccccggtggaagagtttcctcccgagcaatgg
gaccgcatcatcgcaatcaacctgacatcggccttccacacttctgctgctgccatcccc
catatgcgaaaggcgggctggggccgtatcatcaatattgcctcggcgcatggtctcgtg
gcttcgccgttcaaatcggcatatgtcgccgccaagcacggcattgtcggcttcaccaag
acgctggcgctggagcttgccaccgcaaaaatcaccgccaattccatctgtcccggctat
gtgctgacccctctggtggaagcgcagatacccgaccagatgaaagcccaccacatggac
cgtgaaaccgtgatccgcgacgtgatgctggataaacagccgacgaaggagtttgtcacc
accgcgcaaatcggggccgttgccactttcctcgcaagcgatgcggcagcgcagatcaac
ggtgcagccatttccgtcgacggcggctggacggcagaataa

DBGET integrated database retrieval system