KEGG   Brucella melitensis NI: BMNI_I1733Help
Entry
BMNI_I1733        CDS       T01853                                 

Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bmw  Brucella melitensis NI
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bmw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BMNI_I1733
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMNI_I1733
   00620 Pyruvate metabolism
    BMNI_I1733
   00640 Propanoate metabolism
    BMNI_I1733
  Energy metabolism
   00680 Methane metabolism
    BMNI_I1733
Enzymes [BR:bmw01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BMNI_I1733
Lipid biosynthesis proteins [BR:bmw01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BMNI_I1733
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1754581..1756581
Genome map
AA seq 666 aa AA seqDB search
MPDGSIWLQMLKEEIMSEKLYPVLPEAKKNTLIDNETYLEWYEESVSDPDGFWAKHGRRI
DWFKPFTKVKNTDFNGDVTIKWYEDGVTNVSYNCIDRHLKSRGDKVAIIWEGDNPYIDKK
ITYRELYENVCRMANVLKKHGVKKGDRVTIYLPMIPEAAYAMLACARIGAVHSVVFAGFS
PEALAGRIVDCESTFVITADEGVRGGKPVALKENTDTAIDIAAKQYVMVNKVLVVRRTGG
KVSWGRGRDLWYHQEVASVEPHCEPEPMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYA
SMTHQYVFDYHDGEIYWCTADVGWVTGHSYIVYGPLANGATTLMFEGVPNFPDQGRFWEV
VDKHHVNIFYTAPTALRALMGAGDEFVTRSSRSTLRLLGSVGEPINPEAWEWYYNVVGDQ
KCPIVDTWWQTENGGILITPLPGATDLKPGSATRPFFGVKPVLVDNEGNVQECVADGNLC
ISDSWPGQMRTVYGDHKRFIETYFSTYKGMYFSGDGCRRDEDGYYWITGRVDDVLNISGH
RLGTAEIESALVSHHSVSEAAVVGYPHPIKGQGIYCYVTLMTGADAQDPDELRKELVQHV
RKEIGPIATPDKIQFAPGLPKTRSGKIMRRILRKIAEDEFGALGDTSTLADRGVVDDLIE
NRQNKK
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgccggatggttctatttggctgcaaatgctgaaggaggaaatcatgtcggaaaagctt
taccccgtgctgccggaggcaaagaaaaacacgctcatcgacaacgagacttatctcgaa
tggtatgaggagagcgtgagcgacccggatggcttctgggccaagcacggccggcgtatc
gactggttcaagcctttcaccaaggtcaagaacaccgatttcaacggcgatgtaacgatc
aagtggtatgaggatggcgtcaccaacgtctcatataattgcatcgaccgccatctgaag
agccgcggcgacaaggtcgccatcatctgggaaggcgacaacccctatatcgacaagaag
atcacctatcgcgagctttacgagaatgtctgccgcatggcgaatgtgctcaagaagcat
ggggtgaagaagggcgaccgcgtcacgatctatctgccgatgatcccggaagccgcctat
gccatgctcgcctgcgcgcgcatcggcgccgtgcattcggtcgtctttgccggtttctcg
ccggaggcgctcgctggccgcatcgttgactgcgaatccactttcgtcatcaccgccgat
gaaggtgtgcgcggcggcaagcctgttgcgctgaaggaaaacaccgataccgccatcgac
atcgccgccaagcaatatgtgatggtcaacaaggtgctggtcgtgcgccgcaccggcggc
aaggtaagctggggccgcggccgcgatctgtggtaccatcaggaagtcgcaagcgtcgaa
ccgcattgcgaaccggaaccgatgaatgcggaagacccgcttttcattctctacacatcc
ggttccaccggcaagccgaagggtgtgctgcataccaccggcggctacctcgtctatgcc
tcgatgacgcatcaatatgtcttcgattaccatgatggcgagatctactggtgcacggcg
gatgtgggttgggtaacgggccactcctatatcgtctacggaccgctggccaatggcgcg
acaacgctgatgtttgaaggcgtgcccaacttccccgatcagggccgtttctgggaagtc
gtcgacaagcaccatgtcaatatcttctacaccgcgccaaccgcgctgcgcgcgcttatg
ggcgcgggcgatgaattcgtaacccgctcatcgcgttcgacgctgcgcctgctgggctcg
gtcggcgagccgatcaatccagaggcctgggagtggtattacaatgtcgtgggcgaccag
aaatgccccatcgtcgatacctggtggcagacggaaaatggcggcatcctcatcacccca
cttcccggcgcgaccgatttgaaacccggttcggcaacacgcccgttcttcggcgtcaag
ccggtgctggtggacaatgaaggcaatgtgcaggagtgcgtagccgacggcaacctgtgc
atctccgactcctggccgggccagatgcgcaccgtctatggcgaccacaagcgtttcatc
gaaacctacttctccacctataaggggatgtatttttcgggcgatggctgccgccgcgac
gaggacggctattactggatcaccggccgcgtcgatgacgtgctgaatatttccggccat
cgcctcggcacggcggaaatcgaatcggcacttgtctcgcatcactcggtttcggaagcc
gccgtggtcggctatccgcacccgatcaagggacagggcatctattgctatgtcacgctg
atgaccggcgcagacgcgcaggacccggacgagttgcgcaaggaactggtccagcatgtg
cgcaaggaaatcggccccatcgccacaccggacaagatccagtttgcgcccggactgccg
aaaacccgttccggcaagatcatgcgccgcatcctgcgcaagatcgccgaagacgagttc
ggcgcattgggcgacacctcaacgctcgccgatcggggcgtggtggacgacctgatcgaa
aatcgccagaacaagaaatga

DBGET integrated database retrieval system