KEGG   Brucella melitensis NI: BMNI_I1733Help
Entry
BMNI_I1733        CDS       T01853                                 

Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bmw  Brucella melitensis NI
Pathway
bmw00010  Glycolysis / Gluconeogenesis
bmw00620  Pyruvate metabolism
bmw00640  Propanoate metabolism
bmw00680  Methane metabolism
bmw01100  Metabolic pathways
bmw01110  Biosynthesis of secondary metabolites
bmw01120  Microbial metabolism in diverse environments
bmw01130  Biosynthesis of antibiotics
bmw01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bmw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMNI_I1733
   00620 Pyruvate metabolism
    BMNI_I1733
   00640 Propanoate metabolism
    BMNI_I1733
  Energy metabolism
   00680 Methane metabolism
    BMNI_I1733
Enzymes [BR:bmw01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BMNI_I1733
Lipid biosynthesis proteins [BR:bmw01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BMNI_I1733
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AEQ09352
Position
I:1754581..1756581
Genome map
AA seq 666 aa AA seqDB search
MPDGSIWLQMLKEEIMSEKLYPVLPEAKKNTLIDNETYLEWYEESVSDPDGFWAKHGRRI
DWFKPFTKVKNTDFNGDVTIKWYEDGVTNVSYNCIDRHLKSRGDKVAIIWEGDNPYIDKK
ITYRELYENVCRMANVLKKHGVKKGDRVTIYLPMIPEAAYAMLACARIGAVHSVVFAGFS
PEALAGRIVDCESTFVITADEGVRGGKPVALKENTDTAIDIAAKQYVMVNKVLVVRRTGG
KVSWGRGRDLWYHQEVASVEPHCEPEPMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYA
SMTHQYVFDYHDGEIYWCTADVGWVTGHSYIVYGPLANGATTLMFEGVPNFPDQGRFWEV
VDKHHVNIFYTAPTALRALMGAGDEFVTRSSRSTLRLLGSVGEPINPEAWEWYYNVVGDQ
KCPIVDTWWQTENGGILITPLPGATDLKPGSATRPFFGVKPVLVDNEGNVQECVADGNLC
ISDSWPGQMRTVYGDHKRFIETYFSTYKGMYFSGDGCRRDEDGYYWITGRVDDVLNISGH
RLGTAEIESALVSHHSVSEAAVVGYPHPIKGQGIYCYVTLMTGADAQDPDELRKELVQHV
RKEIGPIATPDKIQFAPGLPKTRSGKIMRRILRKIAEDEFGALGDTSTLADRGVVDDLIE
NRQNKK
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgccggatggttctatttggctgcaaatgctgaaggaggaaatcatgtcggaaaagctt
taccccgtgctgccggaggcaaagaaaaacacgctcatcgacaacgagacttatctcgaa
tggtatgaggagagcgtgagcgacccggatggcttctgggccaagcacggccggcgtatc
gactggttcaagcctttcaccaaggtcaagaacaccgatttcaacggcgatgtaacgatc
aagtggtatgaggatggcgtcaccaacgtctcatataattgcatcgaccgccatctgaag
agccgcggcgacaaggtcgccatcatctgggaaggcgacaacccctatatcgacaagaag
atcacctatcgcgagctttacgagaatgtctgccgcatggcgaatgtgctcaagaagcat
ggggtgaagaagggcgaccgcgtcacgatctatctgccgatgatcccggaagccgcctat
gccatgctcgcctgcgcgcgcatcggcgccgtgcattcggtcgtctttgccggtttctcg
ccggaggcgctcgctggccgcatcgttgactgcgaatccactttcgtcatcaccgccgat
gaaggtgtgcgcggcggcaagcctgttgcgctgaaggaaaacaccgataccgccatcgac
atcgccgccaagcaatatgtgatggtcaacaaggtgctggtcgtgcgccgcaccggcggc
aaggtaagctggggccgcggccgcgatctgtggtaccatcaggaagtcgcaagcgtcgaa
ccgcattgcgaaccggaaccgatgaatgcggaagacccgcttttcattctctacacatcc
ggttccaccggcaagccgaagggtgtgctgcataccaccggcggctacctcgtctatgcc
tcgatgacgcatcaatatgtcttcgattaccatgatggcgagatctactggtgcacggcg
gatgtgggttgggtaacgggccactcctatatcgtctacggaccgctggccaatggcgcg
acaacgctgatgtttgaaggcgtgcccaacttccccgatcagggccgtttctgggaagtc
gtcgacaagcaccatgtcaatatcttctacaccgcgccaaccgcgctgcgcgcgcttatg
ggcgcgggcgatgaattcgtaacccgctcatcgcgttcgacgctgcgcctgctgggctcg
gtcggcgagccgatcaatccagaggcctgggagtggtattacaatgtcgtgggcgaccag
aaatgccccatcgtcgatacctggtggcagacggaaaatggcggcatcctcatcacccca
cttcccggcgcgaccgatttgaaacccggttcggcaacacgcccgttcttcggcgtcaag
ccggtgctggtggacaatgaaggcaatgtgcaggagtgcgtagccgacggcaacctgtgc
atctccgactcctggccgggccagatgcgcaccgtctatggcgaccacaagcgtttcatc
gaaacctacttctccacctataaggggatgtatttttcgggcgatggctgccgccgcgac
gaggacggctattactggatcaccggccgcgtcgatgacgtgctgaatatttccggccat
cgcctcggcacggcggaaatcgaatcggcacttgtctcgcatcactcggtttcggaagcc
gccgtggtcggctatccgcacccgatcaagggacagggcatctattgctatgtcacgctg
atgaccggcgcagacgcgcaggacccggacgagttgcgcaaggaactggtccagcatgtg
cgcaaggaaatcggccccatcgccacaccggacaagatccagtttgcgcccggactgccg
aaaacccgttccggcaagatcatgcgccgcatcctgcgcaagatcgccgaagacgagttc
ggcgcattgggcgacacctcaacgctcgccgatcggggcgtggtggacgacctgatcgaa
aatcgccagaacaagaaatga

DBGET integrated database retrieval system