KEGG   Brucella melitensis NI: BMNI_I1809Help
Entry
BMNI_I1809        CDS       T01853                                 

Definition
succinate dehydrogenase, hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
bmw  Brucella melitensis NI
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bmw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BMNI_I1809
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BMNI_I1809
   00650 Butanoate metabolism
    BMNI_I1809
  Energy metabolism
   00190 Oxidative phosphorylation
    BMNI_I1809
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1848600..1848995)
Genome map
AA seq 131 aa AA seqDB search
MNGMNNDMRTPLGKVRGLGSAKEGTSHFWYQRLSAVALVPLVLFFIGLVISLNGASYAEV
RAALSHPFTAVVMALFVLTGVYHMRLGMQVIIEDYVHGEGMKIVLVMLNTFFTVVVGLAC
VFAILKLSFGG
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcatgaataacgatatgcgtactccgctcgggaaggttcgcggtctgggttcg
gcaaaagaaggcaccagccatttctggtatcagcgcctgagcgccgttgccctggtgccg
ctggttctgtttttcatcggcctggtcatttcgctcaatggcgcaagctatgcggaagtc
cgggctgccctgtcacatcccttcaccgctgtggtgatggcgctgtttgtcctcacgggc
gtttatcacatgcgcctgggtatgcaggttattattgaagattatgtgcatggcgaaggc
atgaagatcgtgctggtgatgctgaacaccttctttacggtggtggttggtcttgcctgc
gttttcgcgatcctcaagctcagctttggaggttga

DBGET integrated database retrieval system