KEGG   Brucella melitensis NI: BMNI_I1832Help
Entry
BMNI_I1832        CDS       T01853                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bmw  Brucella melitensis NI
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bmw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BMNI_I1832
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BMNI_I1832
   00640 Propanoate metabolism
    BMNI_I1832
   00660 C5-Branched dibasic acid metabolism
    BMNI_I1832
Enzymes [BR:bmw01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BMNI_I1832
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
I:complement(1869136..1870332)
Genome map
AA seq 398 aa AA seqDB search
MNIHEYQAKRLLHTYGAPIANGVAVYSVEQAEEWAKTLPGPLYVVKSQIHAGGRGKGKFK
ELPADAKGGVRLAKSVEEVVANAKEMLGNTLVTKQTGEAGKQVNRLYIEDGADIERELYL
SILIDRSVGRPAFVVSTEGGMDIEAVAEETPEKIVTVAIDPAKGVTDEDANKLADALKLE
GGAREDGLKLFPILYKAFTEKDMSLLEINPLIVMTNGRVRVLDAKVSFDNNALFRHPDIV
ELRDLTEEDPKEIEASKYDLAYVALDGNIGCMVNGAGLAMATMDIIKLYGAEPANFLDVG
GGASKEKVTAAFKIITADPAVEGILVNIFGGIMKCDVIAEGVIAAVKEVGLKVPLVVRLE
GTNVELGKKIINESGLNVISADDLDDAAQKIVAAVKGN
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcacgaataccaggccaagcgcctgcttcacacctacggcgcgccgatcgcc
aatggtgtggctgtctattccgtcgaacaggcggaagaatgggcaaagacgcttcccgga
ccgctttatgtcgtcaagagccagatccatgctggcggacgcggcaagggcaagttcaag
gaactgcctgccgatgcaaagggcggcgtgcgcctcgccaagtctgtcgaggaagtggtt
gccaatgcgaaggaaatgctgggcaacacgctcgtcaccaagcagaccggcgaagccggc
aagcaggtcaaccgtctctacattgaagatggcgccgatatcgagcgtgagctttatctc
tccatcctgatcgaccgcagcgttggccgtccggcctttgtcgtttcgaccgaaggcggc
atggatattgaagccgttgccgaagaaacccctgaaaagatcgtcaccgtcgccatcgac
ccggccaagggcgtgaccgacgaagatgccaacaagcttgccgatgcgctgaagcttgaa
ggtggagcccgcgaggacggcctgaagctgttcccgatcctttacaaggctttcaccgag
aaggacatgagcctcctcgaaatcaatccgctgatcgtcatgacgaacggtcgcgtgcgc
gttctcgatgccaaggtttcgttcgacaacaacgccctgttccgtcacccggacattgtt
gaactgcgcgacctgacggaagaagatccgaaggaaatcgaagcctccaaatatgacctg
gcctatgtcgccctcgatggcaatatcggctgcatggtcaatggcgccggccttgccatg
gcgacgatggacatcatcaagctctatggcgcagaacctgccaacttcctcgatgttggc
ggcggcgcttccaaggagaaggtgacggctgcgttcaagatcatcaccgccgatccggct
gtcgaaggcattctggtcaacattttcggcggcatcatgaagtgcgatgtcattgccgaa
ggcgtgatcgccgcggtcaaggaagtcggcctcaaggttccgctggttgtccgtctcgaa
ggcaccaatgtcgagcttggcaagaagatcatcaacgagagcggcctgaacgtcatttcg
gccgacgatctcgacgatgcggcgcagaagatcgtcgctgcagtgaaggggaattaa

DBGET integrated database retrieval system