KEGG   Brucella melitensis NI: BMNI_I2006Help
Entry
BMNI_I2006        CDS       T01853                                 

Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bmw  Brucella melitensis NI
Pathway
bmw00260  Glycine, serine and threonine metabolism
bmw00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bmw01100  Metabolic pathways
bmw01110  Biosynthesis of secondary metabolites
bmw01130  Biosynthesis of antibiotics
bmw01230  Biosynthesis of amino acids
Module
bmw_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bmw00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BMNI_I2006
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BMNI_I2006
Enzymes [BR:bmw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BMNI_I2006
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB ThiG DUF561 Pterin_bind
Motif
Other DBs
NCBI-ProteinID: AEQ09625
Position
I:complement(2043812..2044651)
Genome map
AA seq 279 aa AA seqDB search
MTTRIDTKFAELKAEGRPALVTYFMGGDPDLETALKVMKALPKAGADVIELGMPFSDPMA
DGPAIQAAGLRALNAGQTLAKTLYMAAKFRKEDDTTPIVMMGYYNLIYIYGVERFLTDAK
ASGVDGLIVVDLPSEMDAELCIPAMKAGINFIRLTTPTTDDKRLPKVLHNSSGFVYYVSM
NGITGAAIADTAKVGEAVRHIKKSTDLPICVGFGVKTPEQAAAIATHADGVVVGTAIVNA
IAGELDEKGKVKGDPVAAATRLVHALAESVRATRLEAAQ
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgactactcgcatcgacaccaaattcgccgaactgaaggccgagggccgtccggcgctc
gttacctatttcatgggcggcgatcccgatctggaaaccgcgctgaaggtgatgaaagcc
ctgccgaaagccggcgctgacgtgatcgagcttggtatgcccttctccgacccgatggcg
gatggacccgccattcaggcggctggccttcgcgccctgaacgccggacagacgctggcg
aagacgctttatatggcagcaaaattccgcaaggaagacgatacgaccccgatcgtcatg
atgggctattacaatctgatctatatctatggcgtggagcgttttctgaccgatgccaag
gcatccggcgtggatgggctgatcgttgtcgatcttccttccgaaatggatgccgagctt
tgcattccggcaatgaaggcgggcatcaatttcatccgcctcaccacgccgaccacggac
gacaagcgcctgccgaaagtgctgcataattcatcgggctttgtctattatgtctcgatg
aacggcatcaccggcgcggccattgccgatacggcaaaggtcggcgaagcggttcgccat
atcaagaaaagcaccgacctgccgatctgtgtcggtttcggcgtcaagacgccggaacag
gctgcggcaatcgcaacccatgccgatggcgtcgtcgtgggcacggccattgtcaacgca
attgccggtgaactcgatgaaaagggcaaggtgaagggtgatccggttgccgccgcaacc
cggcttgtccacgctcttgcagagagtgtgcgcgccacacgccttgaagccgcccaataa

DBGET integrated database retrieval system