KEGG   Brucella melitensis NI: BMNI_I2008Help
Entry
BMNI_I2008        CDS       T01853                                 

Definition
(GenBank) Tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bmw  Brucella melitensis NI
Pathway
bmw00260  Glycine, serine and threonine metabolism
bmw00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bmw01100  Metabolic pathways
bmw01110  Biosynthesis of secondary metabolites
bmw01130  Biosynthesis of antibiotics
bmw01230  Biosynthesis of amino acids
Module
bmw_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bmw00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BMNI_I2008
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BMNI_I2008
Enzymes [BR:bmw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BMNI_I2008
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Flavodoxin_1
Motif
Other DBs
NCBI-ProteinID: AEQ09627
Position
I:complement(2045118..2046386)
Genome map
AA seq 422 aa AA seqDB search
MLSHSPGAPEHDGAETLNKPVAPNSYKTGPDEEGMFGIFGGRFVAETLMPLILELQQAYE
TAKNDPEFKAELNALSTFYAGRPSKLYYAEGLSKHLGGAKIYFKREDLNHTGSHKINNCL
GQILLAKRMGKTRIIAETGAGQHGVASATVAARFGLPCIVYVGASDVERQKPNVFRMKLL
GAEVKPVSAGNGTLKDAMNEALRDWVTNVEDTYYLIGTAAGPHPYPELVRDFQSVIGTEA
RQQILEQEGRLPDVIVAAVGGGSNAIGLFHPFLDDASVKIVGVEAGGRGLEGEEHCASMS
AGRPGVLHGNRTYLLQNADGQILEGHSVSAGLDYPGVGPEHSWLKDSGRVDYVPILDNEA
LDAFQLCTRTEGIIPALESAHAIAQAVKMAPTMGKDKVMIVNLSGRGDKDVHTVGKLLGM
DI
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgctcagccattcgccaggcgcgcctgaacatgacggagcggaaacgttgaacaagccg
gttgcacccaattcctacaagacgggccctgacgaagagggcatgttcggcatattcggt
ggccgcttcgtcgccgaaacgctgatgcctctgatcctcgaattgcagcaggcttatgaa
acggcgaagaatgaccccgaattcaaggcggagttgaacgccctttccaccttttatgcc
ggccgtccttccaagctctattatgccgaaggcctgagcaaacatctgggtggcgctaaa
atctacttcaagcgcgaagacctgaaccataccggcagccacaagatcaacaattgcctt
ggccagatcctgcttgccaagcgcatgggcaagacgcgcatcatcgcagaaacgggcgcc
ggtcagcatggcgtggcgtctgccaccgttgccgcacgcttcggcctgccctgtatcgtc
tatgtgggcgcaagcgacgtggagcgccagaagcccaatgttttccgcatgaagctgctc
ggcgcggaagtgaagccggtttctgccggcaatggcacgctgaaagacgcgatgaacgaa
gccctgcgtgactgggttacgaatgtcgaggatacctattacctgatcggcacggctgcc
ggtccgcacccctatcccgaactggtgcgcgatttccaatccgtcatcggcaccgaagcg
cgccagcagatactcgaacaggaaggccgcctgccagatgtgatcgtggcagcggtcggc
ggcggctccaacgccattggcctgttccatccgttcctcgacgacgcctcggtgaagatc
gtcggtgtcgaagcaggcggacgcggtcttgagggagaggaacattgcgcttcgatgagc
gcaggccgccccggcgttctgcatggcaaccgcacctatctcctccagaacgcggatggc
caaattctggaaggccattcggtttccgctggtctcgactatccgggcgtcgggcccgag
cattcgtggctgaaggacagcgggcgcgtcgactatgtgccgatcctcgacaatgaggcg
ctggatgcattccagctttgcacccgcaccgaaggcatcatcccggcgctcgaatccgcc
catgccattgcgcaggccgtcaaaatggcgccgacaatgggcaaggacaaggtgatgatc
gtcaatctgtccggccgcggcgacaaggacgtccacacggtcggcaagcttctcggcatg
gatatctga

DBGET integrated database retrieval system