KEGG   Brucella melitensis NI: BMNI_I2081Help
Entry
BMNI_I2081        CDS       T01853                                 

Definition
Enoyl-CoA hydratase
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bmw  Brucella melitensis NI
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bmw00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    BMNI_I2081
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BMNI_I2081
   00650 Butanoate metabolism
    BMNI_I2081
  Lipid metabolism
   00071 Fatty acid degradation
    BMNI_I2081
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BMNI_I2081
   00310 Lysine degradation
    BMNI_I2081
   00360 Phenylalanine metabolism
    BMNI_I2081
   00380 Tryptophan metabolism
    BMNI_I2081
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BMNI_I2081
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BMNI_I2081
   00281 Geraniol degradation
    BMNI_I2081
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BMNI_I2081
   00627 Aminobenzoate degradation
    BMNI_I2081
   00930 Caprolactam degradation
    BMNI_I2081
Enzymes [BR:bmw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BMNI_I2081
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2116115..2116909
Genome map
AA seq 264 aa AA seqDB search
MKEERVYMAYETIIVETRDSVGLIRLNRPQALNALNRAVLEELTDALAAFDADGKVGAVV
LTGSEKAFAAGADIKEMQSINFVDAYLQDMFADWQKVDRIRKPIIAAVSGYALGGGCELA
MMCDFIIAGSNAKFGQPEITLGAIPGMGGSQRLTRYVGKSKAMDMCLTGRMMDAAEAERC
GLVSRVVAPEALLEEALKAAERIASFSRVSVYMAKEAVNRAYETTLDEGLRFERRLFHSL
FATEDQKEGMSAFVDKRTPSFKNR
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaggaacgggtttacatggcctatgaaacaatcatcgttgagacgcgtgacagc
gttggtctcatccgtctcaaccgtccgcaggcgctcaacgcgctcaatcgcgccgtgctt
gaggagctgaccgatgcgcttgccgccttcgacgcggatggcaaggtcggcgccgtggtg
ctgaccggctcggaaaaggctttcgccgccggggccgacatcaaggaaatgcagtcgatc
aatttcgtcgatgcctatttgcaggacatgttcgccgactggcagaaggtggatcgtatc
cgcaagccgattatcgcggctgtttcgggctatgcgctgggcggcggctgcgaactcgcc
atgatgtgcgatttcatcatcgcgggcagcaatgcgaaattcggccagccggaaatcacg
ctgggcgccattcctggcatgggcggctcgcagcgcctgacgcgctatgtcggcaagtcc
aaggctatggatatgtgcctgacgggccgcatgatggatgcagccgaagcggagcgttgc
ggccttgtttcccgcgttgtcgcaccggaggctcttctggaagaggcactgaaagcagcc
gaacgcatcgcatccttctcgcgcgtctcggtctatatggccaaggaagcggtcaaccgc
gcctatgaaacgacgctggacgagggcctgcgtttcgagcgccgcctgttccattcgctt
ttcgcgaccgaagaccagaaggaaggcatgtccgctttcgttgataaacgtaccccttcc
ttcaagaaccgctga

DBGET integrated database retrieval system