KEGG   Brucella melitensis NI: BMNI_II0004Help
Entry
BMNI_II0004       CDS       T01853                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bmw  Brucella melitensis NI
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bmw00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BMNI_II0004
Enzymes [BR:bmw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BMNI_II0004
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:2113..3033
Genome map
AA seq 306 aa AA seqDB search
MKIFVFGSVNVDVSARMAALPRPEQTVNASGYGIGLGGKGANQAVAVAKLGGAIRFVGAV
GHDAFGELALKQMREFGLDTGSVRVIDDVDTGMAIIQVEETGQNTIAVCAGANARCSSAD
IDAYGADIAKARITLLQREVPHEANLAVAKAVRAAGGTVLLDPAPVGDASQMADLIALSD
IISPNETEAAEITGIEPTDLASAEAAGRKLLERGPKIVILKLGSRGALLVTADEVKHFTP
FKVKVVDTVAAGDSFNGGFAVAFSQARPLHDCVRYGSAAGAIAVTRVGAGAAAPTAREVE
ELIGRA
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
ttgaagattttcgttttcggcagtgtgaatgtggatgtaagcgcccgaatggctgccctg
ccgcggccggagcagacggtaaacgcatccggctatggcatcgggctgggtggcaaagga
gccaatcaggcggttgcggtggcaaaacttggcggggcaatccgatttgtcggcgcggtc
ggccatgatgcctttggcgaactggccttaaagcagatgcgcgagtttgggctggatacc
ggcagcgtgcgcgtgatcgatgacgtcgatacaggcatggcgatcatccaggtggaggaa
accgggcagaacacgattgcggtctgtgctggcgccaatgcgcgctgctcgtcagccgat
attgatgcttatggcgctgatattgccaaggcaaggattacgcttttgcagcgcgaagtg
ccgcatgaagccaatctggccgttgcgaaagccgtgcgggcagcgggtggaaccgtcctg
ctcgacccggccccggtgggggatgcaagccagatggccgatcttatcgccctgagcgac
atcatttcgcccaacgagacggaagccgctgaaatcaccggcattgagccgaccgacctc
gcttcggcggaagcggcggggcgcaagcttctggagcgcggcccgaagatcgtcatcctc
aagcttggaagccgtggcgcgctgctggtaacggcggatgaggtgaaacacttcacgccg
ttcaaggtaaaggtggtggatacggttgcagccggtgacagtttcaacggcggctttgcc
gttgctttctcgcaggcgcggcccttgcatgattgcgtgcggtatggttcggcggcgggc
gcgattgcggttacgcgggttggcgcaggcgctgccgcgccaaccgcgcgtgaggttgag
gaactcatcgggcgcgcttga

DBGET integrated database retrieval system