KEGG   Brucella melitensis NI: BMNI_II0167Help
Entry
BMNI_II0167       CDS       T01853                                 

Definition
Cytochrome c2 precursor
Orthology
K08738  
cytochrome c
Organism
bmw  Brucella melitensis NI
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:bmw00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    BMNI_II0167
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BMNI_II0167
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:159123..159569
Genome map
AA seq 148 aa AA seqDB search
MSDYGLGRPNKTKEFSNMRAAMTAISAIAASLLISTVAQGADIESGKKIFNACKACHQIG
EGAKNMVGPELNGLFGRHSGSVEGYKYSDANKNSGIVWDEEIFRKYIKKPREVIPKTKMV
YAGLKDEGKIDDLIAFLKQYDLGGKIKE
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgattatgggctgggccgccccaataaaaccaaggagttcagcaatatgcgtgct
gcaatgaccgcgatttccgcaatcgcagcttcccttttgatctcgactgtcgcgcaaggg
gcggatatcgaatccggcaagaagattttcaacgcatgcaaggcttgccatcagattggt
gagggggcgaaaaatatggtcggccctgagctcaacgggctctttgggcgtcactcgggt
tccgtcgaaggatataagtattccgacgcaaacaagaattccggaattgtctgggatgag
gaaattttccgcaaatacatcaagaagccgcgtgaagtgatcccgaagaccaagatggtc
tatgctggcttgaaggatgagggaaagatcgacgacctgattgcatttctcaagcagtat
gatctgggcggcaagatcaaggaataa

DBGET integrated database retrieval system