KEGG   Brucella melitensis NI: BMNI_II0262Help
Entry
BMNI_II0262       CDS       T01853                                 

Definition
nitrous-oxide reductase
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
bmw  Brucella melitensis NI
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Module
Denitrification, nitrate => nitrogen
Brite
KEGG Orthology (KO) [BR:bmw00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    BMNI_II0262
Enzymes [BR:bmw01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     BMNI_II0262
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:257414..258517
Genome map
AA seq 367 aa AA seqDB search
MMSSEQDWIVVFNLKRIEEAVANGDFKEMNGVPVIDGRHGSKYTRYIPVPNSPHGINTAP
DGIHVVANGKLSPTVTVFDVRKFDDLFDDKIKPRDAVVAEPELGLGPLHTAYDDKGNAYT
TLFIDSQICKWNIEDAKRAFKGEKVDPIRQKLDVHYQPGHNHSSMGQTKEVDGKWLISLN
KFSKDRYLNVGPLKPENDQLIDISGDKMVIVHDGPSFAEPHDATIVHRSKINPVSFWSRE
DPFFADAVAQAKADGLDLMEANEVVRDGNKVRVYMTSSAPAFGLTEFTVQQDDEVTVYVT
NIDEIEDLTHGFAIVNYGVNMEVAPQATASVTFKASKPGVWWYYCSWFCHAMHMEMQGRM
LVEPKKA
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcgagcgagcaggactggattgtcgtcttcaacctgaagcgtatcgaagaagcc
gtcgccaatggcgatttcaaggaaatgaacggtgtgccggtcatcgacggtcgccacggc
tccaaatatacgcgctatattccggtgccgaacagcccgcacggtatcaacaccgcgccg
gacggcatccatgtggtcgccaatggcaagctgtcgccgaccgtgacggtgttcgatgtg
cgcaagttcgacgacctgttcgacgacaagatcaagccgcgcgacgctgttgtggccgag
ccggaactggggcttggaccattgcacacggcctatgatgacaagggcaacgcctatacg
acgctcttcatcgacagccagatctgcaaatggaacattgaagacgccaagcgcgcattc
aagggcgaaaaggtcgatccgatccgtcagaagctcgacgttcattatcagccgggccac
aatcacagctccatgggccaaaccaaggaagttgatggcaagtggctgatttcgctgaac
aagttctccaaggaccgttacctcaatgtcggtccgctcaagcctgagaacgaccagctc
atcgatatttccggcgataagatggtgattgttcacgacggtccgagctttgcggaaccg
catgatgcaacgatcgttcaccgctccaagatcaaccctgtcagcttctggagccgtgag
gatccattttttgccgatgccgtggcgcaggcaaaggcggacggtcttgatctgatggaa
gccaatgaagtggtgcgtgacggcaacaaggtgcgtgtctatatgacgtcttccgcgcct
gccttcggcctcaccgaattcactgtccagcaggatgatgaagtgacggtttatgtcacc
aatatcgatgagatcgaagacctgacccatggtttcgctatcgtcaattacggtgtgaac
atggaagtcgcaccgcaggcgacggcttcggtcacgttcaaggcctccaagccgggtgtg
tggtggtattactgctcgtggttctgccacgccatgcatatggaaatgcagggccgtatg
ctcgtcgaaccgaaaaaggcctga

DBGET integrated database retrieval system