KEGG   Brucella melitensis NI: BMNI_II0322Help
Entry
BMNI_II0322       CDS       T01853                                 

Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
bmw  Brucella melitensis NI
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmw00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BMNI_II0322
   00330 Arginine and proline metabolism
    BMNI_II0322
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BMNI_II0322
Enzymes [BR:bmw01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     BMNI_II0322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:319219..319821
Genome map
AA seq 200 aa AA seqDB search
MSSSSDAIKAALEKGRAAGLSATGGKNADYIPFLASVPSDLFGLAVVTADGQTFKTGDAD
IAFAIESISKVFTLALVMEEIGPDSVREKVGADPTGLPFNSVIALELHNGKSLSPLVNAG
AIATASLVPGDTADARWNNILECQCGFAGRRLKLSNEVNQSNRRPIFTTAPLPGCFTVPV
LATAIRWRPWIFIRANVQRL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagctcatcagatgcgatcaaagccgctcttgagaagggacgcgcagcaggcctt
tctgcaaccggcggcaagaatgccgactatattccattcctggcgtcggttccgtccgac
ctgttcggtctggccgtggtgacggcggacggccagacttttaaaaccggcgatgccgat
atcgccttcgctatcgagtcgatttccaaggttttcacccttgccctggttatggaggag
attggtcccgatagtgtgcgggaaaaggtcggtgctgacccgaccgggctgccgttcaat
tctgtaatcgcgctcgaactccataacggcaagtcgctttcgccgctggtcaatgcaggc
gcaattgcaactgcaagccttgttcccggcgatacggcggatgcccgctggaacaatatt
ctggaatgccagtgcggttttgcgggccgccggctcaagcttagcaacgaggtcaaccag
tcgaacagacgaccaattttcacaaccgcgccattgcctggctgctttacagtgccggta
cttgctacagcgatccgatggaggccgtggatatttatacgcgccaatgttcaacgcttg
taa

DBGET integrated database retrieval system