KEGG   Brucella melitensis NI: BMNI_II0409Help
Entry
BMNI_II0409       CDS       T01853                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bmw  Brucella melitensis NI
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmw00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    BMNI_II0409
Enzymes [BR:bmw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     BMNI_II0409
Exosome [BR:bmw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BMNI_II0409
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(410182..411252)
Genome map
AA seq 356 aa AA seqDB search
MLNHVPGLRERAQKGQVCFGTIDSWLIYKLTGGKAHVTDATNASRTLIYHIGENRWDDEL
LDILGIPAAMLPEVKDCAADFGMTDPALFGVSIPILGVAGDQQAAVIGNACFEPGMMKST
YGTGCFALLNTGTDRVTSSNRLLTTIAYRLDGVTTYALEGSIFIAGAAVQWLRDEMGFIS
VASEVSALAEKADPNQRIYLVPAFTGLGAPYWDAEARGAIFGLTRGTGRAEFARAALESV
AYQTFDLLEAMQGDWKGATNHTVLRVDGGMVASDWTMQRLADILNAPVDRPVFLETTVLG
AAWLAASRAGIWPDRKGFSERWQRDCRFEPAMPEKERESAIAGWRDSVSRCLTRPQ
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
ttgctgaaccatgttccgggcctgcgcgagcgtgcgcaaaaaggtcaagtctgcttcggc
accatcgatagctggctgatctacaagctcaccggcggcaaggcgcatgtaaccgacgcc
acaaatgcctcgcgtacattgatctatcatatcggcgaaaaccgttgggatgatgaactg
ctggacatattgggcattccagccgccatgctgccggaagtgaaggactgcgcggcggat
ttcggcatgacggaccctgcccttttcggcgtttccattcctattctcggcgtagcgggc
gaccagcaggcggcagtgatcggcaatgcctgcttcgagccaggcatgatgaaatccacc
tacggcaccggatgttttgcacttctcaacaccggcacggatcgcgtcacctcctccaac
cggctgctcaccaccatcgcctaccggctcgacggtgttacgacctatgcgctggaaggt
tcgatattcatcgcgggcgcggccgtacaatggcttcgtgacgaaatgggcttcatttcg
gtcgcatcggaagtaagcgcgctggccgaaaaggccgacccgaaccagcgcatctatctg
gttccagccttcaccgggcttggcgcaccctattgggacgccgaagcgcgcggcgcaatc
ttcgggttgacgcgcgggacgggccgcgcagaatttgcccgcgcagcacttgaaagcgtg
gcctatcagaccttcgaccttctggaagccatgcaaggggactggaaaggtgcaaccaat
cacacggtgctgcgcgtcgatggaggcatggttgcttccgactggaccatgcagcgactg
gccgacattctgaacgcacccgtcgatcgcccggtttttcttgaaaccaccgtgctgggc
gccgcatggctggccgcctcccgcgcaggcatctggccggatcgcaagggtttttcggaa
cgctggcagcgtgattgcaggtttgagccggctatgccggaaaaagaacgtgaaagcgcg
attgcgggctggcgggatagcgtttcacgctgcctaacacgaccgcaatag

DBGET integrated database retrieval system