KEGG   Brucella melitensis NI: BMNI_II0564Help
Entry
BMNI_II0564       CDS       T01853                                 

Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bmw  Brucella melitensis NI
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmw00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BMNI_II0564
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BMNI_II0564
Enzymes [BR:bmw01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     BMNI_II0564
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:563463..564431
Genome map
AA seq 322 aa AA seqDB search
MTNQTVSPLFPHRHLLGIKGLSPLDILCLLDLADQEIAVSRQPEKKKSVLRGRTQINLFF
EASTRTQSSFELAGKRLGADVMNMSVGNSSVKKGETLIDTAMTLNAMQPDILVIRHASAG
AAALLAQKVGCSVVNAGDGAHEHPTQALLDALTIRRAKGQIENLIVAICGDVLHSRVARS
NILLLNALGARVRVVAPSTLLPAGMADMSVEVFNSMEEGLKDADVVMMLRLQRERMAGSF
VPSVREYFHFYGLDREKLKFAKPDALVMHPGPMNRGVEIASDVADGPQSVIQQQVEMGVA
VRMAVMEALLDPRRNPGNGEPA
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatcaaacggtctctccgcttttccctcaccgccacctgcttggcatcaagggg
ctatcgcccctggacattctctgccttctcgatcttgccgatcaggaaatcgctgtctcc
cggcagccggagaagaaaaagtccgtgctgcgcggtcgcacgcaaatcaacctgttcttt
gaagcatcgacacggacgcaatcttcgttcgagctggccggaaaacggctgggcgcggat
gtgatgaatatgtccgtcggcaattcatcggtcaagaaaggcgaaacgctcatcgatacg
gcgatgacgctgaacgccatgcagccggatattctcgtcatccgccatgcttccgccggt
gctgccgcccttctcgcgcagaaagtgggttgctcggtggtcaatgcgggcgacggcgcg
catgaacaccccacacaggcgcttctcgatgcgctgacaatccgccgcgccaagggccag
atcgaaaatctgatcgtcgccatctgcggtgacgttctgcattcgcgcgtggcgcgctcc
aacattctcctgctcaacgcgctcggcgcgcgggtgcgggtggttgcgccttcaacactc
ctgcccgccggcatggccgatatgagcgtggaagttttcaactccatggaggaggggctg
aaagacgctgatgtcgtcatgatgctgcgcctccagcgcgagcgcatggcgggttccttc
gtgccttccgtgcgggaatatttccatttctatggcctggaccgggaaaaactcaaattc
gccaaacccgatgcacttgtgatgcatccggggccaatgaaccggggcgtcgagattgcc
tccgacgttgcggacgggccgcaaagcgtcatccagcaacaggtggaaatgggcgttgcc
gtgcgcatggccgtgatggaggctctgctcgatccgcggcgcaacccaggcaacggagaa
ccggcatga

DBGET integrated database retrieval system