KEGG   Brucella melitensis NI: BMNI_II1053Help
Entry
BMNI_II1053       CDS       T01853                                 

Definition
L-fuculose phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
bmw  Brucella melitensis NI
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bmw00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BMNI_II1053
Enzymes [BR:bmw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     BMNI_II1053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:1067872..1068660
Genome map
AA seq 262 aa AA seqDB search
MISLRRRFHTFLDALSTAVLPAYLPKPETGFGKTYVKTNGECKMQMNCDSALLARQSIVD
AMRSFEEKGFNHGSSGNISVREGGHIWVTPTGATSTMDPQDMSLVSLEGEHLAGKIPSSE
WRIHTEIMRAHPEAGAVVHSHADACVALSCLRKPLPPFHYMIASFGGSEVPCASYRVFGS
DALAYEVVRAMGHHRACLMASHGMVVWGRDLAHARLLAEKLETLARQYILACQIGTPALL
SDVELTEVRERYGFYGSQPMPR
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgatttccctgcgcaggcgtttccacacatttctggatgcgctctcaacagcagtgctg
ccagcatatcttcccaaaccggaaaccggttttgggaagacatatgtaaagacaaatggg
gagtgtaaaatgcagatgaattgcgattcggcccttttggcccgacagtccatcgtggat
gcgatgcggtcttttgaggaaaagggattcaatcatggcagcagcggcaacatcagtgtt
cgggaaggcgggcatatttgggtgacgccaacgggcgcgacctcgactatggacccgcag
gacatgagccttgtctcccttgaaggcgagcatctggctggcaaaattccctccagcgaa
tggcgtatccataccgaaatcatgcgggcgcacccggaagccggtgccgtggtccattcc
cacgcagatgcctgcgtggcgctttcctgcctgcgcaagccccttccgccattccattac
atgatcgcttccttcggcgggagcgaggtgccttgtgcgtcatatcgcgtattcggatcg
gacgcgctggcttatgaagtcgtgcgtgcgatggggcaccatcgcgcctgtctgatggca
agccacggcatggtggtgtgggggcgggatctcgcacatgccaggctccttgcagaaaag
ctcgaaacgctggcacggcaatatatattggcctgccagatcggaacacccgccctgttg
agcgatgtcgaactgacggaagtccgggaacgctacggtttttacggcagccaacccatg
ccgcgctga

DBGET integrated database retrieval system