KEGG   Bacteriovorax marinus: BMS_0052Help
Entry
BMS_0052          CDS       T01659                                 

Gene name
recR
Definition
recombination protein
Orthology
K06187  
recombination protein RecR
Organism
bmx  Bacteriovorax marinus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bmx00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BMS_0052 (recR)
DNA repair and recombination proteins [BR:bmx03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BMS_0052 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
55674..56267
Genome map
AA seq 197 aa AA seqDB search
MELPESLLNVIDQLSKIPGVGDKTATRQTLILAKWSADDLNAFGDAMKNLANLKACVDCG
MYSDLDYCEICSNSERKESKSVCVVENVTDCLAIERSGNYEGLYHILGGVLNPLMGVGPD
ELKIDSFVKRVRGLEVKNVILAVNPSVEGDATCSYIKQVLPSDVEVDRIGFGIPMGGSLE
YLDTMTIAKALENKKKM
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
gtggaattaccagagtcactactaaacgtaatagatcaattaagtaaaattccaggtgtt
ggagataagacggccactaggcaaactcttattttggccaaatggtctgctgatgatctg
aatgcctttggagatgcaatgaaaaatcttgcaaacttaaaggcatgcgtagactgtgga
atgtactctgatttagattattgcgaaatatgctcgaattcagaaagaaaagaaagtaag
tctgtttgtgttgttgagaatgtgacagattgcttggccattgagcgtagtggaaattat
gaaggcctttatcatattttgggtggagttctaaatccattgatgggtgttgggccagat
gaattaaaaattgattcatttgtaaaaagagtaagagggttagaagttaagaatgttatt
cttgcagttaatccttcagtcgaaggtgatgcaacttgttcgtatataaagcaagtccta
ccttcagatgtagaagtagatcgaattggattcggaatacctatgggtggaagtcttgag
tacttagatacaatgacaattgcaaaggccctagaaaataaaaagaaaatgtaa

DBGET integrated database retrieval system