KEGG   Bacteriovorax marinus: BMS_0371Help
Entry
BMS_0371          CDS       T01659                                 

Gene name
rfbC
Definition
dTDP-D-glucose 4,6-dehydratase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
bmx  Bacteriovorax marinus
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bmx00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    BMS_0371 (rfbC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BMS_0371 (rfbC)
Enzymes [BR:bmx01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     BMS_0371 (rfbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
386005..386442
Genome map
AA seq 145 aa AA seqDB search
MIEGVKITPLKTIADDRGKIMHMLRSDAEHFSKFGEVYFSFVNNGVIKAWHYHKEMTINY
AVPVGKIDFVLYDSREESSTFGETQVITMSPEDYFLVTVPPRVWNGFKGLSTEPAMVVNC
TDIPHRGDEIERLDFNTDKIPFKWD
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgatagaaggcgttaagataacaccattaaaaactatagctgacgatagaggaaagata
atgcatatgctcagaagtgatgctgagcacttttctaagtttggagaagtctatttttct
tttgtaaataatggcgtgattaaggcctggcattaccataaggaaatgactattaattat
gctgtccctgtaggaaaaatagatttcgtcttatatgattcaagagaagagagttccact
tttggggagacacaggttataacgatgagccctgaggactacttcttagtgacagtacca
cctagagtttggaatggttttaaaggcttgagtactgagccagctatggttgttaattgt
acagatataccacatcgtggcgatgaaattgagaggttagactttaatacagataaaatt
ccattcaagtgggactaa

DBGET integrated database retrieval system