KEGG   Bacteriovorax marinus SJ: BMS_0491Help
Entry
BMS_0491          CDS       T01659                                 

Gene name
gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
bmx  Bacteriovorax marinus SJ
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bmx00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
508048..508614
Genome map
AA seq 188 aa AA seqDB search
MSIGKIIVICAPSGTGKSTLIKKVKAEFTELIESVSYTTRPIREGEQNGVAYNFIDEKTF
LEMKDDNEFLEWAKVHSNYYGTSKSFVESELEKGKNLLFDLDVQGADSFKAYFGDKAQII
FIAPPSIVELEKRLRGRGTDSTGVIQIRLENAKREVLRKDDYDFCVKNEELEVAFNDLKD
VITKILNS
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgagtattggtaaaataattgttatttgcgcaccctctgggactggaaaatcaacttta
ataaagaaggttaaggctgagtttacagagttgattgagtctgtctcttatacaacgagg
cctatcagagaaggtgagcaaaacggtgttgcctataactttattgatgaaaagactttt
cttgagatgaaggatgacaacgagttccttgagtgggcgaaggttcactctaactattat
ggaacttctaaatcatttgttgagtctgagctcgagaaaggtaagaatctgctatttgat
ttagatgtacagggcgcagattcatttaaagcctactttggagataaagcacaaattatc
ttcattgctccgccttctattgttgaactcgagaagagacttagagggagaggtactgat
agcactggtgttattcaaattaggcttgagaatgcaaaaagagaagttttacgtaaagat
gactacgacttttgtgtaaagaatgaagagttggaagtcgctttcaatgatcttaaagat
gtaattacaaaaattttaaattcataa

DBGET integrated database retrieval system