KEGG   Bacteriovorax marinus: BMS_0672Help
Entry
BMS_0672          CDS       T01659                                 

Gene name
pdhC
Definition
dihydrolipoamide acetyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bmx  Bacteriovorax marinus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bmx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BMS_0672 (pdhC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BMS_0672 (pdhC)
  Amino acid metabolism
   00310 Lysine degradation
    BMS_0672 (pdhC)
Enzymes [BR:bmx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BMS_0672 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
692831..694459
Genome map
AA seq 542 aa AA seqDB search
MRHDIVMPQMGESITNGTITKWHKQPGDMVEIDETLLEISTDKVESEIPSPIAGKVVEVI
YPEGDTIDVGILIAVIDDDANATVGGSAPAASAPASTEAPAAASSAPAAGSERMDVVMPQ
MGESITNGTITKWHKQPGDMVEIDETLLEISTDKVESEIPSPVAGRVEEVLFAEGETIDV
GIKIASIEQNLDVPFGASAGAAPAANASAAPATQAASAPAQNTTAQNSGERRFYTPLVKA
LANKHGVALSELANISGSGAGGRVNKADFMNFLNNRGSAPAAATSAPRAAAPSAPAAPVK
SSVPAFSSTDRVEIVPMDNMRKAIAKNMIASKMTSPHVNSIDETDMTNIFKFREGFKNEF
KKQEGFSLTYTHFILYALVQALKEFPIVNASIDGDNIVYKKDINLGCAVAVPGNGLVVPV
IKGADNLNIRGIARKLDELVQKARARKLTMDDMSGGTYTFTNNGSFGILAATPVILQPQL
GIFCVGTMKKRPIVTEDDAIAIRQMMYATHTYDHRLIDGEVGSKFLRHVINTLQTTDWSQ
LF
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgagacacgatatcgtaatgccacaaatgggagagtcgatcacaaacgggacgatcaca
aaatggcataagcaaccaggtgatatggttgaaattgatgaaactcttttagagatttct
acggataaagttgaatctgaaatcccttcaccaattgctggtaaggttgttgaagttatc
taccctgagggagatacaattgacgtaggaattctcattgcagttattgatgatgatgcc
aatgctacagttggtggttctgctcctgcagcatcggcaccagcttcgactgaagcgccg
gcggcagctagttctgcaccagcagctggaagtgagagaatggatgtcgtaatgccacaa
atgggagagtcgattacaaatggaacgatcacaaaatggcacaagcaaccaggtgatatg
gttgaaattgatgaaactcttttagagatctctacggataaagttgaatctgaaatccca
tctcctgttgcaggtagagtggaagaagttctctttgctgaaggtgaaactattgatgtt
ggaataaagattgcttctattgagcaaaatcttgatgtaccttttggtgcgagtgcaggt
gctgctcctgcggcaaatgcatcagctgcgccagctactcaagcggcatcagctcctgct
caaaatacaacggctcaaaattctggagaaagaagattctatactcctctagtaaaagcg
cttgcaaataagcacggtgttgcactaagtgagcttgccaatatttctggaagtggtgct
ggtggaagagtaaataaagcagactttatgaacttcttaaataatagaggatcagctcct
gcagccgcgacttcagctccaagagctgctgcgccaagtgctcctgctgctccagttaag
tcatctgttcctgcgtttagctcaactgatagagttgaaattgttccaatggacaatatg
agaaaggccattgctaagaatatgattgcatctaaaatgacttcaccacacgtgaattca
attgatgaaacagatatgacaaatatctttaagtttagagaaggctttaagaatgagttc
aaaaagcaagagggattctctcttacttatactcacttcattctctacgctctagttcaa
gcattgaaggaattcccaattgtgaatgcttcaattgatggagacaatattgtttacaag
aaagatatcaatcttggttgtgcggtagctgtaccaggaaatggacttgttgttcctgtt
attaagggtgctgacaatctaaatattagaggtatcgcaagaaagcttgatgaattagtt
caaaaagcgagagcaagaaagttaactatggatgatatgagtggtggaacttatacattt
actaataatggttcatttggaattcttgctgcaactccagttatccttcaaccacaactt
ggtatcttctgcgttggtacaatgaagaagcgtccaattgttactgaggatgatgctatt
gctattcgccaaatgatgtatgcaacacatacatatgatcatagactaattgatggtgaa
gttggttctaaattccttagacatgtaatcaacacacttcaaactacagattggtctcaa
ttattctaa

DBGET integrated database retrieval system