KEGG   Bacteriovorax marinus: BMS_0672Help
Entry
BMS_0672          CDS       T01659                                 

Gene name
pdhC
Definition
dihydrolipoamide acetyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bmx  Bacteriovorax marinus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bmx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BMS_0672 (pdhC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BMS_0672 (pdhC)
  Amino acid metabolism
   00310 Lysine degradation
    BMS_0672 (pdhC)
Enzymes [BR:bmx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BMS_0672 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
692831..694459
Genome map
AA seq 542 aa AA seqDB search
MRHDIVMPQMGESITNGTITKWHKQPGDMVEIDETLLEISTDKVESEIPSPIAGKVVEVI
YPEGDTIDVGILIAVIDDDANATVGGSAPAASAPASTEAPAAASSAPAAGSERMDVVMPQ
MGESITNGTITKWHKQPGDMVEIDETLLEISTDKVESEIPSPVAGRVEEVLFAEGETIDV
GIKIASIEQNLDVPFGASAGAAPAANASAAPATQAASAPAQNTTAQNSGERRFYTPLVKA
LANKHGVALSELANISGSGAGGRVNKADFMNFLNNRGSAPAAATSAPRAAAPSAPAAPVK
SSVPAFSSTDRVEIVPMDNMRKAIAKNMIASKMTSPHVNSIDETDMTNIFKFREGFKNEF
KKQEGFSLTYTHFILYALVQALKEFPIVNASIDGDNIVYKKDINLGCAVAVPGNGLVVPV
IKGADNLNIRGIARKLDELVQKARARKLTMDDMSGGTYTFTNNGSFGILAATPVILQPQL
GIFCVGTMKKRPIVTEDDAIAIRQMMYATHTYDHRLIDGEVGSKFLRHVINTLQTTDWSQ
LF
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgagacacgatatcgtaatgccacaaatgggagagtcgatcacaaacgggacgatcaca
aaatggcataagcaaccaggtgatatggttgaaattgatgaaactcttttagagatttct
acggataaagttgaatctgaaatcccttcaccaattgctggtaaggttgttgaagttatc
taccctgagggagatacaattgacgtaggaattctcattgcagttattgatgatgatgcc
aatgctacagttggtggttctgctcctgcagcatcggcaccagcttcgactgaagcgccg
gcggcagctagttctgcaccagcagctggaagtgagagaatggatgtcgtaatgccacaa
atgggagagtcgattacaaatggaacgatcacaaaatggcacaagcaaccaggtgatatg
gttgaaattgatgaaactcttttagagatctctacggataaagttgaatctgaaatccca
tctcctgttgcaggtagagtggaagaagttctctttgctgaaggtgaaactattgatgtt
ggaataaagattgcttctattgagcaaaatcttgatgtaccttttggtgcgagtgcaggt
gctgctcctgcggcaaatgcatcagctgcgccagctactcaagcggcatcagctcctgct
caaaatacaacggctcaaaattctggagaaagaagattctatactcctctagtaaaagcg
cttgcaaataagcacggtgttgcactaagtgagcttgccaatatttctggaagtggtgct
ggtggaagagtaaataaagcagactttatgaacttcttaaataatagaggatcagctcct
gcagccgcgacttcagctccaagagctgctgcgccaagtgctcctgctgctccagttaag
tcatctgttcctgcgtttagctcaactgatagagttgaaattgttccaatggacaatatg
agaaaggccattgctaagaatatgattgcatctaaaatgacttcaccacacgtgaattca
attgatgaaacagatatgacaaatatctttaagtttagagaaggctttaagaatgagttc
aaaaagcaagagggattctctcttacttatactcacttcattctctacgctctagttcaa
gcattgaaggaattcccaattgtgaatgcttcaattgatggagacaatattgtttacaag
aaagatatcaatcttggttgtgcggtagctgtaccaggaaatggacttgttgttcctgtt
attaagggtgctgacaatctaaatattagaggtatcgcaagaaagcttgatgaattagtt
caaaaagcgagagcaagaaagttaactatggatgatatgagtggtggaacttatacattt
actaataatggttcatttggaattcttgctgcaactccagttatccttcaaccacaactt
ggtatcttctgcgttggtacaatgaagaagcgtccaattgttactgaggatgatgctatt
gctattcgccaaatgatgtatgcaacacatacatatgatcatagactaattgatggtgaa
gttggttctaaattccttagacatgtaatcaacacacttcaaactacagattggtctcaa
ttattctaa

DBGET integrated database retrieval system