KEGG   Bacteriovorax marinus: BMS_0713Help
Entry
BMS_0713          CDS       T01659                                 

Gene name
tdk
Definition
thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
bmx  Bacteriovorax marinus
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmx00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BMS_0713 (tdk)
Enzymes [BR:bmx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     BMS_0713 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
730548..731189
Genome map
AA seq 213 aa AA seqDB search
MSPYLASFMTGSVEVVCGPMFSGKTEELIRRVRRAQIAKQKIQIFKPALDDRYHETKVVS
HSSQSVAATPVNSAVDILKRIYDSTRIVAIDEVQFFDENIIKVVNKLSRRGVRVILAGLD
QDYKGEPFGPMPHLMAIADDVTKVKAVCTSCGAPASKTHRKSTDNSDQVLVGEADLYEAR
CTAHWDYQPDDEDLLAFSTNIEAQEGSMTEVQI
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
gtgtccccgtatctagcaagcttcatgacaggaagtgttgaagtcgtttgtggcccaatg
ttttctggtaaaaccgaagagttaattagaagagtaagaagagcacaaattgctaagcag
aaaatccaaatctttaaaccagcactcgatgatagatatcatgagacaaaagtcgtaagc
cactcgtctcaatctgttgctgctacacctgttaattcagctgtagatattcttaaaaga
atttatgattcaactagaatagtggccattgatgaggtgcagttctttgatgaaaatatt
attaaagttgtgaataagctctctagaagaggggttagggttattctcgctggtttagac
caggactataagggagagccgtttggaccaatgccacatctaatggcaattgctgatgac
gtaactaaggttaaggccgtttgtacttcttgtggagcgccggcctctaagactcataga
aagtctactgataactctgaccaggttctagttggagaagcagacctctatgaagcacgt
tgtactgcgcattgggattatcagccagatgatgaggatctactcgcattttcaacaaat
atcgaggcccaagagggctcaatgactgaagttcagatttaa

DBGET integrated database retrieval system