KEGG   Halobacteriovorax marinus: BMS_0720Help
Entry
BMS_0720          CDS       T01659                                 

Gene name
gpo
Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
bmx  Halobacteriovorax marinus
Pathway
bmx00480  Glutathione metabolism
bmx00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:bmx00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    BMS_0720 (gpo)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BMS_0720 (gpo)
Enzymes [BR:bmx01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BMS_0720 (gpo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin EF-hand_5
Motif
Other DBs
NCBI-ProteinID: CBW25624
UniProt: E1X5Q7
Position
complement(736609..737088)
Genome map
AA seq 159 aa AA seqDB search
MSIYDYKVKNNKNEEIDLSEYKDKVLLIVNTASKCGFTPQYEGLQELYKKYKDQGLEVLA
FPCNQFGSQEPGSNEEIASFCDLQFNISFPLFDKIDVNGDGTHPLYQYLKEQAPGLLGSK
KIKWNFTKFLVSKDGAKITRFAPTSKPESLESDIKNLLK
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgagcatttacgattacaaagtgaagaataataagaatgaagaaatcgatctctctgaa
tataaagataaagttctcctaatcgtaaatacagcttctaagtgtggattcactccccag
tacgaaggccttcaggaactttataagaagtataaagatcaaggtctagaagtgcttgcc
tttccatgtaaccaattcggatctcaggaaccaggtagtaatgaagagattgcatctttt
tgtgatctgcaatttaatattagcttccctctttttgataaaatcgatgttaatggagat
ggaacacatcccctctatcaatacctaaaagaacaagctcctggacttcttggctctaag
aaaatcaagtggaattttactaaattcctagtctcaaaagatggcgcaaagattacgagg
tttgcaccgacgagtaagcctgagtcacttgagagtgatattaagaacttacttaaatag

DBGET integrated database retrieval system