KEGG   Bacteriovorax marinus: BMS_0884Help
Entry
BMS_0884          CDS       T01659                                 

Definition
cytochrome C551 peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
bmx  Bacteriovorax marinus
Brite
Enzymes [BR:bmx01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     BMS_0884
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
869892..871181
Genome map
AA seq 429 aa AA seqDB search
MIFKVLLLIFASNSITLANTVLDQRLKSYIKTFQLKAVEKPAGLNEVKYLLGEKLFSDKL
LSGNRNISCSTCHSPELGSGDGLPLPIGEGGHGEGKSRVAKNASQIIPRNSPPLYNLGHD
DMEFMFWDGRVHYRSDWDVYTTPSEVLNGDYPERWDITEALGSALAAQALFPLLSHEEMR
GRAGTNEIANAKTDEQAWKLLLERVLKVGEYRKLFKDSFPRAEEINIGHLANALAHFQKH
RFAVYDTPWDNYLRGDQGAMSAKAKRGALVFFEGGMCIRCHNGTLLGGFAFAGVAAPQTG
PGKDVKHNDEGRFLITKNAMDKYQFRVPPLRNISKTAPYFHSGSYQTLEDVIEHYRSGMK
GIDNYNGRWLDQYLGENYPERLFVETNRYMNFKKKEMAHPVISGQVIRMSESQKAELLLF
LKDSLNQRD
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgatctttaaagttttactactgatttttgcctccaattctatcactttggccaatact
gtcttagatcaaagattaaagtcttatattaaaacttttcaattaaaggccgtggagaaa
ccggcaggtttaaatgaagtgaagtacctcttgggggaaaaactttttagtgacaagctc
ctctcaggcaatagaaatattagctgctctacatgccattctccagagctaggaagtgga
gacggtcttcctcttccaattggagaaggtggtcacggagaaggaaagagtagagttgcg
aagaatgcttcacaaattattcctagaaattcacccccactttataacttaggtcacgat
gatatggagttcatgttttgggatggtcgtgttcattatagaagtgattgggatgtttat
acgactcctagtgaagttttaaatggagactatcctgagagatgggatatcaccgaagca
ctggggagtgcgcttgcggcacaagcactctttccactactatcacacgaagagatgcgc
gggcgagctggaacaaatgaaattgcaaatgctaagactgacgagcaggcatggaagtta
ctcttagaacgtgttcttaaagtaggtgagtatagaaaactttttaaagactcctttcca
agggccgaggaaattaatattggtcaccttgcaaatgctttagctcactttcaaaaacat
cgcttcgctgtctatgatactccctgggataattacctaagaggagatcaaggggccatg
agtgctaaagcaaagcgtggggcactagttttctttgaaggggggatgtgtattcgttgc
cacaatggaacacttctggggggatttgcattcgctggtgttgctgctcctcaaaccggt
cccggaaaagatgtcaaacataatgatgaagggcgttttttaattacgaaaaatgcaatg
gataaataccaatttagagtaccaccacttagaaatatttctaagacagctccatacttt
cactcggggtcttaccaaacattggaagatgtaatcgagcactatagaagtggaatgaaa
gggatagataattacaatggtcgttggttagatcagtacttgggagagaactatcctgag
cgcttatttgttgaaacaaatcgctatatgaactttaagaaaaaagagatggcccatcct
gtaatttctggacaggttattagaatgagtgagtcccaaaaagctgagttactactcttt
ttaaaggactctttaaaccaaagagactaa

DBGET integrated database retrieval system