KEGG   Halobacteriovorax marinus: BMS_0987Help
Entry
BMS_0987          CDS       T01659                                 

Gene name
acs
Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bmx  Halobacteriovorax marinus
Pathway
bmx00010  Glycolysis / Gluconeogenesis
bmx00620  Pyruvate metabolism
bmx00640  Propanoate metabolism
bmx00680  Methane metabolism
bmx01100  Metabolic pathways
bmx01110  Biosynthesis of secondary metabolites
bmx01120  Microbial metabolism in diverse environments
bmx01130  Biosynthesis of antibiotics
bmx01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bmx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMS_0987 (acs)
   00620 Pyruvate metabolism
    BMS_0987 (acs)
   00640 Propanoate metabolism
    BMS_0987 (acs)
  Energy metabolism
   00680 Methane metabolism
    BMS_0987 (acs)
Enzymes [BR:bmx01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BMS_0987 (acs)
Lipid biosynthesis proteins [BR:bmx01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BMS_0987 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: CBW25871
UniProt: E1WXR5
Position
957612..959510
Genome map
AA seq 632 aa AA seqDB search
MDWKIKSLEEYALAYQESRSNPELYWGKVADTFKWNKKWESVLSGSIEDANIKWFDGAEL
NITENCLDRHLEERGDKVALIYEPNDPNEPALEYTYKQLHTAVCKTANMLKAQGVEKGDR
VCLYMSMVPELMISVLACARIGAIHSVVFGGFSAHALAGRIEDCDCKILITNDAGHRGEK
IIHLKDIADKALDDLDNSPVQKVIVHKRVGNDIEMKEGRDLWWHDLYKEASSDYPSETMQ
AEDPLFILYTSGSTGKPKGVLHTTAGYMVWAAYTFGNVFQMNEEDRYWCTADIGWITGHT
YLTYGPLLNGVTTTMFEGIPTFPNPGRFWEVVDKHKITHFYTAPTAVRALMACDPSFVTN
NNLDSLKVLGSVGEPINAEAWHWYNKSIGKEKCPIVDTWWQTETGGILISSLAGVTEGKP
CFATLPLPGVFPALMDAEGKVIEERESEGNLCITRPWPGMLRSIWGDHERFKQTYLSAYP
GSYFTGDGCKRDADGLYRITGRVDDVLNVSGHRIGTAEVENAIGQHPDVIESAIVGFPHD
IKGQGIYAYVIASENHSPEEMREEILKVITEEIGPIAKPDKIQIVPGLPKTRSGKIMRRI
LRKIAAKEFDNFGDTSTLLDPSIVDKIKDGAL
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atggattggaaaattaagagtctagaggaatatgcactggcctatcaagagtcgcgaagt
aacccagaactttactggggaaaggtggccgacacttttaagtggaataagaagtgggag
agtgtccttagcggaagtatagaggatgccaatataaagtggtttgatggtgcagagtta
aatattactgaaaactgcttagatagacacttagaagagagaggcgataaagtcgctctt
atttatgagcctaacgatcctaatgagccagcacttgagtatacatataagcaattacat
actgcagtttgcaagaccgctaatatgcttaaagcacagggggtagagaaaggagataga
gtttgtctttatatgtctatggttcctgaacttatgatttctgtattggcctgtgcacga
ataggtgcaattcactctgttgtctttggaggtttctcagctcacgccctagcgggaaga
attgaagattgtgattgtaaaattcttattacgaatgatgctggtcacagaggggagaag
ataattcacctaaaagacattgcagataaggcattggatgatttagataattctcccgtt
caaaaagtcattgttcacaaaagagtgggaaatgatattgaaatgaaagagggaagagat
ctatggtggcatgatctttataaagaggcttcttcagattatccaagtgagactatgcaa
gcagaagatcctctctttattctttatacttcaggatctacaggaaaaccaaaaggtgtc
ttacatacgactgctggatatatggtctgggcagcatatacttttggaaatgttttccaa
atgaatgaggaagatcgctattggtgtacagcagatattggttggattacaggacatact
tatttaacctatggtccactgctaaacggtgttactacaacaatgtttgaagggattcca
actttcccaaaccctggaagattttgggaggttgtggataagcataagatcactcacttc
tatactgctccaacagcagtgagggcccttatggcgtgtgacccatcatttgttaccaat
aataatttagactcattgaaagttttgggctcagtaggcgaacctattaatgcagaagca
tggcattggtataataagtctattggaaaagagaaatgccctatcgttgatacttggtgg
caaacagagactggaggaattttaatctcctctctggcaggagtcacagaggggaaacct
tgttttgcaactctaccgcttcctggagtctttcctgcgctaatggatgccgaaggaaaa
gttatcgaagaaagggagtcggaaggaaatctctgtattacaaggccatggcctggaatg
cttagaagtatttggggtgatcatgagagatttaagcaaacttatttaagtgcttatcca
gggagttactttactggagatggatgtaagcgcgacgctgatggactatatagaattact
ggacgagtggatgatgtcttaaatgtttcaggtcaccgtattggaaccgctgaagtggag
aacgcaattggacagcatcctgatgttatagagtcagcaattgttggctttcctcatgat
ataaaggggcaggggatttatgcctatgtcatagccagtgagaaccatagtccagaagag
atgagagaggagattctaaaagttatcacagaagaaattggtcccattgcaaaaccagat
aaaattcaaattgttccaggtttaccaaagactaggtctggaaaaattatgagaagaatt
ctaagaaaaattgctgccaaagaatttgataattttggtgatacatcaacactacttgat
ccaagtattgtcgataaaattaaagacggcgctttatag

DBGET integrated database retrieval system