KEGG   Bacteriovorax marinus SJ: BMS_1201Help
Entry
BMS_1201          CDS       T01659                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
bmx  Bacteriovorax marinus SJ
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:bmx00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1162054..1163481
Genome map
AA seq 475 aa AA seqDB search
MTVRVRFAPSPTGYLHIGGARTALYSYLFAKARGGKYILRVEDTDLERSKREYEEAQIAD
LLWLGIEHDEGPDKGGEFGPYRQSERMQIYKDIAWDFVERGLAYPCFLTSDELEELTNKA
NEEKVAPHAYHGKYRDYDLAKAKERIESGEEHVIRFKNPGKKWTFTDLVRGEVTFPEDMV
GDFVIIRSNGMPVYNFCCVVDDYKMGMTHVFRAEEHLNNTCRQLQIYEALGATPPEFAHV
SLLVGEDRQKLSKRHGATSVTQYKEMGYLPKAVTNYLTLLGWSHPEEKDIFDVLELGDAF
DYTRFSKSSAMYDIKKLNYFNEQWLRKLSDQEIASGFEHALGSESEFSSMTAQWKEKFAG
LMKEKVQLFSDIKEFMPIFFDAGADEDEQYTEAISWETTPQVKEYLKSQVDALSSDFITE
DQVGEWMNYLKKDLKIKGKPLFMGMRVCLTGRAHGPDLKTVVSLTPISIVKERLN
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgacagtaagagtacgttttgctccatccccaactggttacctacatattggtggcgct
cgtacagcgctttatagctatctcttcgccaaggcgagaggtggtaagtacattcttaga
gtagaggatactgacctcgaaagatctaagcgcgagtatgaagaagctcagattgcagat
cttctatggttaggaattgagcacgatgaaggacctgataaaggtggagagtttggccct
tatagacagtctgaaagaatgcagatttataaagacatcgcttgggacttcgttgaaaga
ggattggcctacccatgttttcttacgagcgacgagctagaggaattaactaataaagct
aatgaagagaaggttgctcctcatgcctatcacggaaagtatagagattatgatctcgcg
aaggcaaaagagagaattgaatctggcgaagagcacgttattagatttaagaaccctggt
aagaagtggacatttactgaccttgtaagaggtgaggtgactttccctgaagatatggtg
ggtgactttgttattattcgttcaaatgggatgcctgtatataacttctgctgtgttgtt
gatgactataaaatgggaatgactcatgtctttagagcagaagagcacttaaataataca
tgtagacagttacaaatttatgaagcacttggtgcaactcctcctgagtttgctcacgtt
tctcttcttgttggtgaagatagacaaaaactctctaagagacatggagcaacttcggta
actcaatataaagaaatgggttaccttcctaaggcggttacaaattacttaacacttcta
ggttggtctcaccctgaagagaaagatatctttgatgtcttagagctaggtgacgctttt
gattacacaagattttcaaagtcatcggccatgtatgatattaagaaattaaattacttc
aatgagcagtggttaagaaagttgagtgatcaagagattgccagtgggtttgagcatgca
cttggaagtgagagtgagttctcgtctatgactgctcagtggaaagagaagtttgcagga
ctgatgaaagagaaagttcaactattcagtgatatcaaagaatttatgcctatctttttt
gatgctggagcagatgaagatgaacaatacactgaagccatttcttgggaaacgactcct
caagtaaaagaatatttaaagtcgcaagttgatgctttaagctcagattttatcactgaa
gatcaagttggcgagtggatgaattacttaaagaaagatttaaagataaaagggaagcca
ctatttatgggaatgagagtttgcttaacgggtagagctcatggaccagatttaaaaaca
gttgtttctttaactccaatttctattgtgaaagaaaggttaaattag

DBGET integrated database retrieval system