KEGG   Bacteriovorax marinus: BMS_1350Help
Entry
BMS_1350          CDS       T01659                                 

Definition
putative acyl-CoA thioesterase precursor
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
bmx  Bacteriovorax marinus
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:bmx00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    BMS_1350
Enzymes [BR:bmx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     BMS_1350
   3.1.2  Thioester hydrolases
    3.1.2.-  
     BMS_1350
Lipid biosynthesis proteins [BR:bmx01004]
 Fatty acid synthase
  Component type
   BMS_1350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1319376..1319975
Genome map
AA seq 199 aa AA seqDB search
MAKLLLILSILFSYSAFSKTKVLFIGDSLTEGYGVAKESAYPMILKSLLKEKHKKDIEVI
NGSVSGSTTASGLSRLKWFLRSKPEVLVLALGANDGLRGIKLDSSKENLKAIIKLAKDKN
MKVILAGMYMPPNYGPDYTKKFRNMFTALKEEMKIDLIPFLLDGVAAKKELNLSDGIHPN
ELGHKKMAENLLPYFRFLK
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggctaaattacttttaattctatcaattttattttcttattctgcattttctaagaca
aaagttctctttatcggagattctctgaccgagggttatggagtggccaaagaaagtgct
tatccaatgattttaaaaagccttctcaaagaaaagcataagaaagatatcgaagttatt
aacggtagtgtttctgggtctactactgccagtggtttatctaggctcaagtggtttcta
agatctaagcccgaggttttagttttggccttgggagcaaatgacggactaagaggaatt
aaattagattcatctaaggaaaatttaaaggccattatcaaactagcaaaagataagaat
atgaaagttatcttagctggaatgtatatgcctcccaattatggaccagactatacaaag
aaatttagaaatatgtttaccgctcttaaagaggagatgaagattgatttaatccctttt
ctcttagatggagtggcggccaagaaagagctcaacctctccgatggtattcatcccaat
gaactaggtcataagaaaatggccgagaacttacttccatactttaggtttttaaaatga

DBGET integrated database retrieval system