KEGG   Bacteriovorax marinus SJ: BMS_1350Help
Entry
BMS_1350          CDS       T01659                                 

Definition
putative acyl-CoA thioesterase precursor
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
bmx  Bacteriovorax marinus SJ
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:bmx01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1319376..1319975
Genome map
AA seq 199 aa AA seqDB search
MAKLLLILSILFSYSAFSKTKVLFIGDSLTEGYGVAKESAYPMILKSLLKEKHKKDIEVI
NGSVSGSTTASGLSRLKWFLRSKPEVLVLALGANDGLRGIKLDSSKENLKAIIKLAKDKN
MKVILAGMYMPPNYGPDYTKKFRNMFTALKEEMKIDLIPFLLDGVAAKKELNLSDGIHPN
ELGHKKMAENLLPYFRFLK
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggctaaattacttttaattctatcaattttattttcttattctgcattttctaagaca
aaagttctctttatcggagattctctgaccgagggttatggagtggccaaagaaagtgct
tatccaatgattttaaaaagccttctcaaagaaaagcataagaaagatatcgaagttatt
aacggtagtgtttctgggtctactactgccagtggtttatctaggctcaagtggtttcta
agatctaagcccgaggttttagttttggccttgggagcaaatgacggactaagaggaatt
aaattagattcatctaaggaaaatttaaaggccattatcaaactagcaaaagataagaat
atgaaagttatcttagctggaatgtatatgcctcccaattatggaccagactatacaaag
aaatttagaaatatgtttaccgctcttaaagaggagatgaagattgatttaatccctttt
ctcttagatggagtggcggccaagaaagagctcaacctctccgatggtattcatcccaat
gaactaggtcataagaaaatggccgagaacttacttccatactttaggtttttaaaatga

DBGET integrated database retrieval system