KEGG   Bacteriovorax marinus SJ: BMS_1528Help
Entry
BMS_1528          CDS       T01659                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
bmx  Bacteriovorax marinus SJ
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bmx00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1506151..1507134
Genome map
AA seq 327 aa AA seqDB search
MMTYRPRRNRNSKSIRNLIRENALTSNDLIAPLFVIEGENQSVAIDSMPGQYRLSIDLLV
KEVEELWELGVPCVSLFPALDDSKKDKYATESYNDDGLFQRAIRAVKKACPEILVMSDVA
MDPYSSDGHDGVVSDDGEILNDETLEILAKMSLSQAKAGSDIIGPSDMMDGRIGYIRDAL
DEAGFTNTIIMSYTAKYASAFYGPFRDALDSAPKSGDKKTYQMDFANKREAIRETILDEQ
EGADILMVKPGISYLDIISDMRSNTTLPIAAYNVSGEYAMVKAADEKGWIDGEAVMMEML
TSFKRAGCDMILTYFAKEAATLLRANR
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgatgacctatagacctagaagaaatagaaattcaaaatctattagaaaccttatccgt
gaaaatgctctaacgagtaatgacctcattgctccactctttgttatagaaggggagaat
cagtctgtggccattgactctatgcctggtcaatatagattgagtattgatttactagtt
aaggaagttgaagaactttgggaattaggtgttccatgtgtatcactctttcctgcttta
gatgattctaaaaaagataagtacgcaacagagtcttataatgacgatggactttttcaa
agggccattagggcggtaaagaaagcttgtccagaaatactcgtgatgagtgatgtggcc
atggacccgtattctagtgatggtcatgatggagttgtctccgatgatggagaaatttta
aacgatgagacactagaaattttggcaaagatgtccctctctcaggccaaggccggaagt
gatattattggcccttctgatatgatggatggaagaattggttatattagagacgcactt
gatgaagcaggattcactaatacaattattatgtcttacactgctaagtatgcctctgca
ttctatggcccatttagagacgctctagattcagcgcctaaatcgggagataagaagact
tatcaaatggactttgccaataagagagaggccataagagaaacaattttagatgagcaa
gagggagcagatattctcatggtaaagccagggattagttacctcgatattattagcgat
atgagatctaatacaactcttcctattgctgcttataacgttagtggagaatacgccatg
gtaaaggcggcagatgaaaagggttggattgacggtgaagctgtaatgatggagatgtta
acttcattcaaaagagcgggctgtgatatgatccttacttattttgcgaaagaagctgcg
actcttctgagagcgaatagatag

DBGET integrated database retrieval system