KEGG   Bacteriovorax marinus: BMS_1592Help
Entry
BMS_1592          CDS       T01659                                 

Definition
hypothetical protein
Organism
bmx  Bacteriovorax marinus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1568143..1568922)
Genome map
AA seq 259 aa AA seqDB search
MLTSFSSFALSCNNFKQQITFEDDIKGIILIVHGLNLNPEKMESLGNFYKAKKIAPIYVR
LTGHTENTNWDQVTKQRWIKDFYSPLCQAYVNSKQLDIPMYGLGFSLGALVIQHAIEKFN
APFKSVSYIAPAFKTRWYTMFITALFKMGLTFEIPSGNFVEYRAKDSTGLLAYKGMWEIT
QELKFNDNIKKVITMDKRDELIDYFSTRDLCKSWSNCQMEELISSPSKNEKKIYHLAIDS
ATLGQKAWNKLTLILSQQL
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgctaacaagttttagcagcttcgcgttaagctgcaataacttcaaacaacagattact
tttgaagacgatatcaagggtatcattctcatcgttcatggactcaatctcaaccccgag
aaaatggagtctcttggcaacttctataaggccaaaaaaatcgctccaatatatgttcga
ctcacagggcacacagaaaatacaaattgggatcaggtgacaaagcagagatggatcaaa
gatttctactctcccctttgccaggcctatgtaaattcaaagcagcttgatatccctatg
tatggacttggcttctcactaggcgctctagtcattcaacacgcaattgaaaaattcaat
gctccctttaagtcagttagctatattgctccggcctttaaaacccgttggtacaccatg
ttcataacagcgctctttaaaatggggctcacttttgaaatcccaagtggaaactttgtt
gagtaccgagcaaaggattcaacaggtctcttggcctataaagggatgtgggaaataact
caggaacttaagtttaatgacaatataaagaaagtaataacaatggataagagagacgag
cttatcgactatttctctacccgcgatttgtgtaaatcttggagcaattgccagatggaa
gaattgatatcttccccttcaaagaacgagaagaaaatctaccatttggccattgatagt
gcgactttaggtcagaaggcatggaataaactcactcttattttaagtcagcagctctga

DBGET integrated database retrieval system