KEGG   Bacteriovorax marinus: BMS_1592Help
Entry
BMS_1592          CDS       T01659                                 

Definition
hypothetical protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
bmx  Bacteriovorax marinus
Brite
Enzymes [BR:bmx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     BMS_1592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1568143..1568922)
Genome map
AA seq 259 aa AA seqDB search
MLTSFSSFALSCNNFKQQITFEDDIKGIILIVHGLNLNPEKMESLGNFYKAKKIAPIYVR
LTGHTENTNWDQVTKQRWIKDFYSPLCQAYVNSKQLDIPMYGLGFSLGALVIQHAIEKFN
APFKSVSYIAPAFKTRWYTMFITALFKMGLTFEIPSGNFVEYRAKDSTGLLAYKGMWEIT
QELKFNDNIKKVITMDKRDELIDYFSTRDLCKSWSNCQMEELISSPSKNEKKIYHLAIDS
ATLGQKAWNKLTLILSQQL
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgctaacaagttttagcagcttcgcgttaagctgcaataacttcaaacaacagattact
tttgaagacgatatcaagggtatcattctcatcgttcatggactcaatctcaaccccgag
aaaatggagtctcttggcaacttctataaggccaaaaaaatcgctccaatatatgttcga
ctcacagggcacacagaaaatacaaattgggatcaggtgacaaagcagagatggatcaaa
gatttctactctcccctttgccaggcctatgtaaattcaaagcagcttgatatccctatg
tatggacttggcttctcactaggcgctctagtcattcaacacgcaattgaaaaattcaat
gctccctttaagtcagttagctatattgctccggcctttaaaacccgttggtacaccatg
ttcataacagcgctctttaaaatggggctcacttttgaaatcccaagtggaaactttgtt
gagtaccgagcaaaggattcaacaggtctcttggcctataaagggatgtgggaaataact
caggaacttaagtttaatgacaatataaagaaagtaataacaatggataagagagacgag
cttatcgactatttctctacccgcgatttgtgtaaatcttggagcaattgccagatggaa
gaattgatatcttccccttcaaagaacgagaagaaaatctaccatttggccattgatagt
gcgactttaggtcagaaggcatggaataaactcactcttattttaagtcagcagctctga

  All links  
No link information was found.   
DBGET integrated database retrieval system