KEGG   Halobacteriovorax marinus: BMS_1633Help
Entry
BMS_1633          CDS       T01659                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
bmx  Halobacteriovorax marinus
Pathway
bmx00480  Glutathione metabolism
bmx00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:bmx00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    BMS_1633
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BMS_1633
Enzymes [BR:bmx01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BMS_1633
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: CBW26477
UniProt: E1X0Y8
Position
1619960..1620508
Genome map
AA seq 182 aa AA seqDB search
MSNLLDIKFKNNKNEEVSIKDFDAKAYLIVNVASKCGLTPQYEGLQSLYSEYKDKGLEIL
AFPANEFLGQEPGSDEEIQSFCSLTYNVTFPVNSKIIVKGEGQHELYKELTNAKVDYTKN
EDGKFETLLTEKGLITGGEEDIKWNFEKFLVSKDGEVVSRFFPDVEASDVRLKEALENLI
NS
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatttactagatattaaatttaagaataataagaatgaagaagtcagcattaaa
gactttgatgctaaggcgtatctcatcgttaacgtggcttcaaagtgcggcctaacacca
cagtatgaaggtcttcaatctctttactcagagtataaagacaaaggtctagaaattttg
gccttccctgccaatgaattccttgggcaggagccaggaagtgatgaagaaatccaaagc
ttttgttctctaacttataatgtaacatttcctgttaactcaaaaattattgttaaaggt
gagggacagcacgaactttataaggaattaactaatgctaaagttgattatacaaagaat
gaagatggaaagtttgaaacgcttctcacagagaaaggcctaattacaggtggagaagaa
gatattaagtggaactttgagaaattccttgtctctaaggacggcgaagttgtttctaga
ttcttcccagatgtagaggccagtgatgtgaggctaaaagaggccctagaaaatttaata
aattcgtaa

DBGET integrated database retrieval system