KEGG   Bacteriovorax marinus SJ: BMS_1684Help
Entry
BMS_1684          CDS       T01659                                 

Gene name
folA
Definition
putative dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
bmx  Bacteriovorax marinus SJ
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bmx00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:bmx00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1671342..1671710
Genome map
AA seq 122 aa AA seqDB search
MIMGRKTFESIGRPLPKRETIILTRDKNYSYEGCKVFHSMEEIEDYLISKGETDAAVVGG
GEIYKLYLPKCSKMYLSYVDFAGQADTFFPEFDESEWVRSEEISHEAYENFLAWEFVELS
RK
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgattatggggcgcaaaacttttgagtctatcgggcgccctctccctaagagagagacg
attattctcacaagagataagaattactcttatgaagggtgtaaagtctttcactctatg
gaggagatagaagattatctaatctcaaaaggtgagactgatgctgctgttgttggtggg
ggagagatttataagctctatcttccaaagtgctctaagatgtatttaagttatgtagac
tttgcgggacaagcagatacattctttccagaatttgatgaaagcgagtgggtaagaagt
gaggagatttctcacgaagcctatgagaatttcttggcctgggaatttgtggaactctct
agaaaatag

DBGET integrated database retrieval system