KEGG   Bacteriovorax marinus: BMS_1684Help
Entry
BMS_1684          CDS       T01659                                 

Gene name
folA
Definition
putative dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
bmx  Bacteriovorax marinus
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BMS_1684 (folA)
   00670 One carbon pool by folate
    BMS_1684 (folA)
Enzymes [BR:bmx01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     BMS_1684 (folA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1671342..1671710
Genome map
AA seq 122 aa AA seqDB search
MIMGRKTFESIGRPLPKRETIILTRDKNYSYEGCKVFHSMEEIEDYLISKGETDAAVVGG
GEIYKLYLPKCSKMYLSYVDFAGQADTFFPEFDESEWVRSEEISHEAYENFLAWEFVELS
RK
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgattatggggcgcaaaacttttgagtctatcgggcgccctctccctaagagagagacg
attattctcacaagagataagaattactcttatgaagggtgtaaagtctttcactctatg
gaggagatagaagattatctaatctcaaaaggtgagactgatgctgctgttgttggtggg
ggagagatttataagctctatcttccaaagtgctctaagatgtatttaagttatgtagac
tttgcgggacaagcagatacattctttccagaatttgatgaaagcgagtgggtaagaagt
gaggagatttctcacgaagcctatgagaatttcttggcctgggaatttgtggaactctct
agaaaatag

DBGET integrated database retrieval system